AFfirm™ PPA1 Mouse Monoclonal Antibody - #BF9504
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
cytosolic inorganic pyrophosphatase; diphosphate phosphohydrolase; inorganic diphosphatase; inorganic pyrophosphatase 1; Inorganic pyrophosphatase; IOPPP; IPYR_HUMAN; PP; PP1; PPA1; PPase; Pyp; pyrophosphatase, inorganic, 1; Pyrophosphate phospho hydrolase; Pyrophosphate phospho-hydrolase; SID6-8061;
Immunogens
A synthesized peptide derived from human PPA1, corresponding to a region within the internal amino acids.
- Q15181 IPYR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
Research Backgrounds
Cytoplasm.
Expressed ubiquitously.
Belongs to the PPase family.
Research Fields
· Metabolism > Energy metabolism > Oxidative phosphorylation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.