TIMP1 Recombinant Rabbit mAb - #BF3238

(2)   Copy Info
Product: TIMP1 Recombinant Rabbit mAb
Catalog: BF3238
Description: Rabbit monoclonal antibody to TIMP1
Application: WB IHC IF/ICC
Reactivity: Human
Mol.Wt.: 26 kDa(Observed); 23kD(Calculated).
Uniprot: P01033

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:200-1:1000, IF/ICC 1:200-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm22685]
Specificity:
TIMP1 Recombinant Rabbit mAb detects endogenous levels of TIMP1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Clgi; Collagenase inhibitor; Collagenase inhibitor, Human; EPA; EPO; Erythroid Potentiating Activity; Erythroid-potentiating activity; Fibroblast collagenase inhibitor; FLJ90373; HCI; Human Collagenase Inhibitor; Metalloproteinase inhibitor 1; Metalloproteinase inhibitor 1 precursor; OTTHUMP00000023214; TIMP 1; TIMP; TIMP metallopeptidase inhibitor 1; TIMP-1; Timp1; TIMP1 protein; TIMP1_HUMAN; Tissue Inhibitor of Metalloproteinase 1; Tissue inhibitor of metalloproteinases 1; Tissue inhibitor of metalloproteinases; Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor;

Immunogens

Immunogen:

A synthetic peptide from human TIMP1

Uniprot:

P01033(TIMP1_HUMAN) >>Visit HPA database.

Gene(ID):
TIMP1(7076)
Expression:
P01033 TIMP1_HUMAN:

Detected in rheumatoid synovial fluid (at protein level).

Description:
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs),a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs,the encoded protein is able to promote cell proliferation in a wide range of cell types,and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition,the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction.
Sequence:
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Research Backgrounds

Function:

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.

PTMs:

The activity of TIMP1 is dependent on the presence of disulfide bonds.

N-glycosylated.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in rheumatoid synovial fluid (at protein level).

Family&Domains:

Belongs to the protease inhibitor I35 (TIMP) family.

Research Fields

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.