CXCL5 Recombinant Rabbit mAb - #BF3290

Copy Info
Product: CXCL5 Recombinant Rabbit mAb
Catalog: BF3290
Description: Rabbit monoclonal antibody to CXCL5
Application: WB IF/ICC
Reactivity: Human
Mol.Wt.: 8 kDa(Observed); 12kD(Calculated).
Uniprot: P42830

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000, IF/ICC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm22737]
Specificity:
CXCL5 Recombinant Rabbit mAb detects endogenous levels of CXCL5.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AMCFII; C-X-C motif chemokine 5; C-X-C motif chemokine ligand 5; chemokine (C-X-C motif) ligand 5; Cxcl5; CXCL5_HUMAN; ENA 78; ENA-78 (8-78); ENA-78(1-78); ENA-78(9-78); ENA78; Epithelial derived neutrophil activating protein 78; Epithelial-derived neutrophil-activating protein 78; Lipopolysaccharide-induced CXC chemokine; Neutrophil activating peptide ENA 78; Neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5; Small inducible cytokine B5; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); small inducible cytokine subfamily B, member 5; Small-inducible cytokine B5;

Immunogens

Immunogen:

A synthetic peptide from human CXCL5

Uniprot:

P42830(CXCL5_HUMAN) >>Visit HPA database.

Gene(ID):
CXCL5(6374)
Description:
This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines,which recruit and activate leukocytes,are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils,to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation,migration,and invasion.
Sequence:
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Research Backgrounds

Function:

Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

PTMs:

N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.