NUR77 Recombinant Rabbit mAb - #BF3356

(3)   Copy Info
Product: NUR77 Recombinant Rabbit mAb
Catalog: BF3356
Description: Rabbit monoclonal antibody to NUR77
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 65 kDa(Observed); 64kD(Calculated).
Uniprot: P22736

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm22803]
Specificity:
NUR77 Recombinant Rabbit mAb detects endogenous levels of NUR77.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Early response protein NAK1; GFRP 1; GFRP; GFRP1; Growth factor inducible nuclear protein N10; Growth Factor Inducible Nuclear Protein NP10; Growth Factor Response Protein 1; Hbr1; HMR; Hormone Receptor; MGC9485; N10; N10 nuclear protein; NAK 1; NAK1; Nerve growth factor IB nuclear receptor variant 1; NGFIB; NP 10; NP10; NR4A1; NR4A1_HUMAN; Nuclear hormone receptor NUR/77; Nuclear Hormone Receptor TR3; Nuclear receptor subfamily 4 group A member 1; NUR77; NUR77, mouse, homolog of; Orphan nuclear receptor HMR; Orphan nuclear receptor NR4A1; Orphan nuclear receptor TR3; Orphan receptor tr3; Receptor NGFIB; ST 59; ST-59; ST59; Steroid receptor TR3; Testicular receptor 3; TR 3; TR3; TR3 orphan receptor;

Immunogens

Immunogen:

A synthetic peptide from human NUR77

Uniprot:

P22736(NR4A1_HUMAN) >>Visit HPA database.

Gene(ID):
NR4A1(3164)
Expression:
P22736 NR4A1_HUMAN:

Fetal muscle and adult liver, brain and thyroid.

Description:
This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Sequence:
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

Research Backgrounds

Function:

Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity). May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation. Plays a role in the vascular response to injury (By similarity).

PTMs:

Phosphorylated at Ser-351 by RPS6KA1 and RPS6KA3 in response to mitogenic or stress stimuli.

Acetylated by p300/CBP, acetylation increases stability. Deacetylated by HDAC1.

Subcellular Location:

Nucleus. Cytoplasm. Mitochondrion.
Note: Nuclear export to the cytoplasm is XPO1-mediated and positively regulated by IFI27 (PubMed:22427340). Translocation to the mitochondrion upon interaction with RXRA and upon the presence of 9-cis retinoic acid (PubMed:17761950).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Fetal muscle and adult liver, brain and thyroid.

Family&Domains:

Belongs to the nuclear hormone receptor family. NR4 subfamily.

Research Fields

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.