MIP-1 alpha Recombinant Rabbit mAb - #BF3744

Copy Info
Product: MIP-1 alpha Recombinant Rabbit mAb
Catalog: BF3744
Description: Rabbit monoclonal antibody to MIP-1 alpha
Application: IF/ICC
Reactivity: Human
Mol.Wt.: 10 kDa(Observed); 10kD(Calculated).
Uniprot: P10147

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
IF/ICC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23191]
Specificity:
MIP-1 alpha Recombinant Rabbit mAb detects endogenous levels of MIP-1 alpha.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C C motif chemokine 3; CCL 3; CCL3; CCL3_HUMAN; Chemokine C C motif ligand 3; G0/G1 switch regulatory protein 19 1; G0/G1 switch regulatory protein 19-1; G0S19 1; G0S19 1 protein; Heparin binding chemotaxis protein; L2G25B; LD78 alpha; LD78-alpha(4-69); LD78alpha; Macrophage inflammatory protein 1 alpha; Macrophage inflammatory protein 1-alpha; MIP 1 alpha; MIP 1A; MIP-1-alpha; MIP-1-alpha(4-69); MIP1A; PAT 464.1; SCYA 3; SCYA3; SIS alpha; SIS beta; SIS-beta; Small inducible cytokine A3; small inducible cytokine A3 (homologous to mouse Mip-1a); Small-inducible cytokine A3; Tonsillar lymphocyte LD78 alpha protein;

Immunogens

Immunogen:

A synthetic peptide from human MIP-1 alpha

Uniprot:

P10147(CCL3_HUMAN) >>Visit HPA database.

Gene(ID):
CCL3(6348)
Description:
This locus represents a small inducible cytokine. The encoded protein,also known as macrophage inflammatory protein 1 alpha,plays a role in inflammatory responses through binding to the receptors CCR1,CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
Sequence:
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Research Backgrounds

Function:

Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

PTMs:

N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.