EFNA2 Antibody - #AF0335

Product: | EFNA2 Antibody |
Catalog: | AF0335 |
Description: | Rabbit polyclonal antibody to EFNA2 |
Application: | WB IF/ICC |
Cited expt.: | WB |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Chicken |
Mol.Wt.: | 24kDa; 24kD(Calculated). |
Uniprot: | O43921 |
RRID: | AB_2833495 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0335, RRID:AB_2833495.
Fold/Unfold
EFNA 2; efna2; EFNA2_HUMAN; ELF1; Eph related receptor tyrosine kinase ligand 6; EPH-related receptor tyrosine kinase ligand 6; Ephrin-A2; EphrinA2; EPLG6; HEK7 L; HEK7 ligand; HEK7-L; HEK7L; LERK 6; LERK-6; LERK6; Ligand of eph related kinase 6;
Immunogens
A synthesized peptide derived from human EFNA2, corresponding to a region within N-terminal amino acids.
- O43921 EFNA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. With the EPHA2 receptor may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis (By similarity).
Cell membrane>Lipid-anchor.
Belongs to the ephrin family.
Research Fields
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Organismal Systems > Development > Axon guidance. (View pathway)
References
Application: WB Species: human Sample: PCa
Application: WB Species: Human Sample: LNCaP cell
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.