Product: EFNA2 Antibody
Catalog: AF0335
Description: Rabbit polyclonal antibody to EFNA2
Application: WB IF/ICC
Reactivity: Human, Mouse
Prediction: Pig, Zebrafish, Bovine, Chicken
Mol.Wt.: 24kDa; 24kD(Calculated).
Uniprot: O43921
RRID: AB_2833495

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Zebrafish(82%), Bovine(100%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
EFNA2 Antibody detects endogenous levels of total EFNA2.
RRID:
AB_2833495
Cite Format: Affinity Biosciences Cat# AF0335, RRID:AB_2833495.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EFNA 2; efna2; EFNA2_HUMAN; ELF1; Eph related receptor tyrosine kinase ligand 6; EPH-related receptor tyrosine kinase ligand 6; Ephrin-A2; EphrinA2; EPLG6; HEK7 L; HEK7 ligand; HEK7-L; HEK7L; LERK 6; LERK-6; LERK6; Ligand of eph related kinase 6;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
EFNA2 Belongs to the ephrin family. Binds to the receptor tyrosine kinases EPHA3, EPHA4 and EPHA5.
Sequence:
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Chicken
100
Zebrafish
82
Horse
0
Sheep
0
Dog
0
Xenopus
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - O43921 As Substrate

Site PTM Type Enzyme
K125 Acetylation

Research Backgrounds

Function:

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. With the EPHA2 receptor may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis (By similarity).

Subcellular Location:

Cell membrane>Lipid-anchor.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Binds to the receptor tyrosine kinases EPHA3, EPHA4 and EPHA5. Interacts with EPHA8; activates EPHA8.

Family&Domains:

Belongs to the ephrin family.

Research Fields

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Organismal Systems > Development > Axon guidance.   (View pathway)

References

1). Exosomal ephrinA2 derived from serum as a potential biomarker for prostate cancer. Journal of Cancer (PubMed: 30087706) [IF=3.9]

Application: WB    Species: human    Sample: PCa

Fig. 1. |Expression of ephrinA2 in tissues and serum. A. Expression of ephrin A2 protein in 9 pairs of PCa tissues by western blotting (N, adjacent tissue; T, tumor tissue). The result shows the representative western blots in four pairs. B. Expression of ephrinA2 protein in 20 healthy controls, 21 BPH patients and 50 PCa patients measured via ELISA.

2). Ephrin-A2 promotes prostate cancer metastasis by enhancing angiogenesis and promoting EMT. JOURNAL OF CANCER RESEARCH AND CLINICAL ONCOLOGY (PubMed: 33772606) [IF=3.6]

Application: WB    Species: Human    Sample: LNCaP cell

Fig. 1 Ephrin-A2 was assessed in established stable cell lines through Western blotting analysis: a Ephrin-A2 level was detected in PC-3 cell lines (Left panel). The relative expression of ephrin-A2 was normalized to that in PC-3 cells (Right panel). b Ephrin-A2 level was detected in DU145 cell lines (Left panel). Ephrin-A2 relative level expression was normalized to that in DU145/NC cells (Right panel) c Ephrin-A2 level was detected in LNCaP cell lines (Left panel). Ephrin-A2 relative level expression was normalized to that in LNCaP/NC cells (Right panel). *P<0.05 compared with the control group

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.