LPCAT1 Recombinant Rabbit mAb - #BF4230

Copy Info
Product: LPCAT1 Recombinant Rabbit mAb
Catalog: BF4230
Description: Rabbit monoclonal antibody to LPCAT1
Application: WB IHC IF/ICC
Reactivity: Human
Mol.Wt.: 29 kDa(Observed); 59kD(Calculated).
Uniprot: Q8NF37

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:200-1:2000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23680]
Specificity:
LPCAT1 Recombinant Rabbit mAb detects endogenous levels of LPCAT1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

1 acylglycerophosphocholine O acyltransferase; 1 alkylglycerophosphocholine O acetyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; Acetyl CoA:lyso PAF acetyltransferase; Acetyl CoA:lyso platelet activating factor acetyltransferase; Acetyl-CoA:lyso-PAF acetyltransferase; Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; Acyl CoA:lysophosphatidylcholine acyltransferase 1; Acyltransferase like 2; Acyltransferase-like 2; AGPAT10; AGPAT9; AYTL1; AYTL2; FLJ12443; FLJ41609; LPC acyltransferase 1; LPC acyltransferase; lpcat; LPCAT-1; LPCAT1; Lyso PAF acetyltransferase; Lyso-PAF acetyltransferase; LysoPAFAT; LysoPC acyltransferase 1; Lysophosphatidylcholine acyltransferase 1; PCAT1_HUMAN; PFAAP3; Phosphonoformate immuno associated protein 3; Phosphonoformate immuno-associated protein 3;

Immunogens

Immunogen:

A synthetic peptide from human LPCAT1

Uniprot:

Q8NF37(PCAT1_HUMAN) >>Visit HPA database.

Gene(ID):
LPCAT1(79888)
Description:
This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism,specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor (PAF). Elevated expression of this gene may contribute to the progression of oral squamous cell,prostate,breast,and other human cancers.
Sequence:
MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD

Research Backgrounds

Function:

Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent (By similarity). Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively. May synthesize phosphatidylcholine in pulmonary surfactant, thereby playing a pivotal role in respiratory physiology. Involved in the regulation of lipid droplet number and size.

Subcellular Location:

Endoplasmic reticulum membrane>Single-pass type II membrane protein. Golgi apparatus membrane>Single-pass type II membrane protein. Lipid droplet.
Note: May adopt a monotopic topology when embedded in the lipid monolayer of the lipid droplet, with both termini exposed to the cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine.

The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.

Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Research Fields

· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.

· Metabolism > Lipid metabolism > Ether lipid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.