MtSSB Antibody - #DF3240
| Product: | MtSSB Antibody |
| Catalog: | DF3240 |
| Description: | Rabbit polyclonal antibody to MtSSB |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 17 KD; 17kD(Calculated). |
| Uniprot: | Q04837 |
| RRID: | AB_2835620 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3240, RRID:AB_2835620.
Fold/Unfold
mitochondrial; Mt SSB; Mt-SSB; MtSSB; PWP1 interacting protein 17; PWP1-interacting protein 17; SENSOR OF SINGLE-STRANDED DNA COMPLEX; Single stranded DNA binding protein 1; Single stranded DNA binding protein; Single stranded DNA binding protein mitochondrial; Single-stranded DNA-binding protein; SOSS B1; SOSS COMPLEX, SUBUNIT B1; SSBP 1; SSBP; SSBP_HUMAN; SSBP1;
Immunogens
A synthesized peptide derived from human MtSSB, corresponding to a region within the internal amino acids.
- Q04837 SSBP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Binds preferentially and cooperatively to pyrimidine rich single-stranded DNA (ss-DNA). In vitro, required to maintain the copy number of mitochondrial DNA (mtDNA) and plays crucial roles during mtDNA replication that stimulate activity of the replisome components POLG and TWNK at the replication fork. Promotes the activity of the gamma complex polymerase POLG, largely by organizing the template DNA and eliminating secondary structures to favor ss-DNA conformations that facilitate POLG activity. In addition it is able to promote the 5'-3' unwinding activity of the mtDNA helicase TWNK. May also function in mtDNA repair.
Mitochondrion. Mitochondrion matrix>Mitochondrion nucleoid.
Research Fields
· Genetic Information Processing > Replication and repair > DNA replication.
· Genetic Information Processing > Replication and repair > Mismatch repair.
· Genetic Information Processing > Replication and repair > Homologous recombination.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.