FHL2 Recombinant Rabbit mAb - #BF4532

(1)   Copy Info
Product: FHL2 Recombinant Rabbit mAb
Catalog: BF4532
Description: Rabbit monoclonal antibody to FHL2
Application: WB IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 32 kDa(Observed); 32kD(Calculated).
Uniprot: Q14192

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23982]
Specificity:
FHL2 Recombinant Rabbit mAb detects endogenous levels of FHL2.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AAG 11; AAG11; Aging associated gene 11; Down regulated in rhabdomyosarcoma LIM protein; Downregulated in rhabdomyosarcoma LIM protein; DRAL; FHL 2; FHL-2; Fhl2; FHL2 protein; FHL2_HUMAN; Four and a half LIM domain protein 2; Four and a half LIM domains 2; Four and a half LIM domains protein 2; KIAA0990; LIM domain protein DRAL; Skeletal muscle LIM protein 3; Skeletal muscle LIM-protein 3; SLIM 3; SLIM-3; SLIM3;

Immunogens

Immunogen:

A synthetic peptide from human FHL2

Uniprot:

Q14192(FHL2_HUMAN) >>Visit HPA database.

Gene(ID):
FHL2(2274)
Expression:
Q14192 FHL2_HUMAN:

Expressed in skeletal muscle and heart.

Description:
This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved,tandemly arranged,zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also,this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified.
Sequence:
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI

Research Backgrounds

Function:

May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation. Negatively regulates the calcineurin/NFAT signaling pathway in cardiomyocytes.

Subcellular Location:

Cytoplasm. Nucleus. Cytoplasm>Myofibril>Sarcomere>Z line.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in skeletal muscle and heart.

Family&Domains:

The third LIM zinc-binding mediates interaction with E4F1.

Research Fields

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.