CDK5R1/P35 Antibody - #DF3284
| Product: | CDK5R1/P35 Antibody |
| Catalog: | DF3284 |
| Description: | Rabbit polyclonal antibody to CDK5R1/P35 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 38 KD; 34kD(Calculated). |
| Uniprot: | Q15078 |
| RRID: | AB_2835652 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3284, RRID:AB_2835652.
Fold/Unfold
CD5R1_HUMAN; CDK5 activator 1; CDK5P35; CDK5R; CDK5R1; Cyclin dependent kinase 5 regulatory subunit 1; Cyclin-dependent kinase 5 activator 1; Cyclin-dependent kinase 5 regulatory subunit 1; NCK 5A; Neuronal CDK5 activator; p23; p25; p35; Regulatory partner for CDK5 kinase; Tau protein kinase II 23 kDa subunit; TPKII regulatory subunit;
Immunogens
A synthesized peptide derived from human CDK5R1/P35, corresponding to a region within N-terminal amino acids.
- Q15078 CD5R1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution.
The p35 form is proteolytically cleaved by calpain, giving rise to the p25 form. P35 has a 5 to 10 fold shorter half-life compared to p25. The conversion results in deregulation of the CDK5 kinase: p25/CDK5 kinase displays an increased and altered tau phosphorylation in comparison to the p35/CDK5 kinase in vivo (By similarity).
Myristoylated. A proper myristoylation signal is essential for the proper distribution of p35.
Ubiquitinated. Degradation of p35 by proteasome results in down-regulation of CDK5 activity. During this process, CDK5 phosphorylates p35 and induces its ubiquitination and subsequent degradation.
Phosphorylation at Ser-8 and Thr-138 by CDK5 prevents calpain-mediated proteolysis.
Cell membrane>Lipid-anchor>Cytoplasmic side. Cell projection>Neuron projection.
Note: In the primary cortical neurons, p35 is present in the peripheries and nerve terminals.
Nucleus. Cytoplasm>Perinuclear region. Perikaryon.
Note: The conversion of p35 to p25 relocalizes the protein from the cell periphery to the cytoplasm, in nuclear and perinuclear regions. In the primary cortical neurons, p25 is primarily concentrated in the cell soma and is largely absent from neurites.
Brain and neuron specific.
Belongs to the cyclin-dependent kinase 5 activator family.
Research Fields
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Substance dependence > Cocaine addiction.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.