Cytochrome P450 24A1 Antibody - #DF3568
| Product: | Cytochrome P450 24A1 Antibody |
| Catalog: | DF3568 |
| Description: | Rabbit polyclonal antibody to Cytochrome P450 24A1 |
| Application: | WB IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human |
| Prediction: | Rabbit, Dog |
| Mol.Wt.: | 60 KD; 59kD(Calculated). |
| Uniprot: | Q07973 |
| RRID: | AB_2835940 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3568, RRID:AB_2835940.
Fold/Unfold
1 25 @dihydroxyvitamin D3 24 hydroxylase; 1 25 dihydroxyvitamin D(3) 24 hydroxylase; 1; 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; 24 OHase; 24-OHase; 25-dihydroxyvitamin D(3) 24-hydroxylase; CP 24; CP24; CP24A_HUMAN; CYP 24; CYP24; CYP24A1; Cytochrome P450 24A1; Cytochrome P450 24A1 mitochondrial; cytochrome P450 CC24; Cytochrome P450 family 24; Cytochrome P450 family 24 subfamily A member 1; Cytochrome P450 family 24 subfamily A polypeptide 1; Cytochrome P450 subfamily XXIV; Cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase); Cytochrome P450-CC24; EC 1.14.13.n4; Exo mitochondrial protein; HCAI; HCINF1; MGC126273; MGC126274; mitochondrial; P450 CC24; Vitamin D 24 hydroxylase; Vitamin D(3) 24 hydroxylase; Vitamin D(3) 24-hydroxylase;
Immunogens
A synthesized peptide derived from human Cytochrome P450 24A1, corresponding to a region within C-terminal amino acids.
- Q07973 CP24A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
A cytochrome P450 monooxygenase with a key role in vitamin D catabolism and calcium homeostasis. Via C24- and C23-oxidation pathways, catalyzes the inactivation of both the vitamin D precursor calcidiol (25-hydroxyvitamin D(3)) and the active hormone calcitriol (1-alpha,25-dihydroxyvitamin D(3)). With initial hydroxylation at C-24 (via C24-oxidation pathway), performs a sequential 6-step oxidation of calcitriol leading to the formation of the biliary metabolite calcitroic acid. With initial hydroxylation at C-23 (via C23-oxidation pathway), catalyzes sequential oxidation of calcidiol leading to the formation of 25(OH)D3-26,23-lactone as end product. Preferentially hydroxylates at C-25 other vitamin D active metabolites, such as CYP11A1-derived secosteroids 20S-hydroxycholecalciferol and 20S,23-dihydroxycholecalciferol. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via FDXR/adrenodoxin reductase and FDX1/adrenodoxin.
Mitochondrion.
Belongs to the cytochrome P450 family.
Research Fields
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
· Metabolism > Lipid metabolism > Steroid biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: WB Species: Human Sample: HK-2 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.