KCNMB2 Antibody - #DF3862
| Product: | KCNMB2 Antibody |
| Catalog: | DF3862 |
| Description: | Rabbit polyclonal antibody to KCNMB2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 30 KD; 27kD(Calculated). |
| Uniprot: | Q9Y691 |
| RRID: | AB_2836219 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3862, RRID:AB_2836219.
Fold/Unfold
2700049B16Rik; 3110031N04Rik; BK channel subunit beta 2; BK channel subunit beta-2; BKbeta2; Calcium activated potassium channel subfamily M subunit beta 2; Calcium activated potassium channel subunit beta 2; Calcium-activated potassium channel; Calcium-activated potassium channel subunit beta-2; Charybdotoxin receptor subunit beta 2; Charybdotoxin receptor subunit beta-2; Hbeta2; Hbeta3; K(VCA)beta-2; K(VCA)beta2; KCMB2_HUMAN; KCNMB 2; Kcnmb2; Large conductance Ca2+ activated K+ channel beta2 subunit; Large conductance calcium activated potassium channel beta 2 subunit; Maxi K channel subunit beta 2; Maxi K channel subunit beta-2; MaxiK channel beta 2 subunit; MGC22431; MGC57945; Potassium large conductance calcium activated channel subfamily M beta member 2; Slo-beta-2; Slobeta2; subfamily M subunit beta-2;
Immunogens
A synthesized peptide derived from human KCNMB2, corresponding to a region within the internal amino acids.
Expressed in kidney, heart and brain. Highly expressed in ovary. Expressed at low level in other tissues.
- Q9Y691 KCMB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Acts as a negative regulator that confers rapid and complete inactivation of KCNMA1 channel complex. May participate in KCNMA1 inactivation in chromaffin cells of the adrenal gland or in hippocampal CA1 neurons.
N-glycosylated.
Membrane>Multi-pass membrane protein.
Expressed in kidney, heart and brain. Highly expressed in ovary. Expressed at low level in other tissues.
The ball and chain domain mediates the inactivation of KCNMA1. It occludes the conduction pathway of KCNMA1 channels, and comprises the pore-blocking ball domain (residues 1-17) and the chain domain (residues 20-45) linking it to the transmembrane segment. The ball domain is made up of a flexible N-terminus anchored at a well ordered loop-helix motif. The chain domain consists of a 4-turn helix with an unfolded linker at its C-terminus.
Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB2 subfamily.
Research Fields
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
· Organismal Systems > Endocrine system > Insulin secretion. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.