Product: FCGR2C Antibody
Catalog: DF4802
Description: Rabbit polyclonal antibody to FCGR2C
Application: WB IF/ICC
Reactivity: Human
Mol.Wt.: 35 KD; 36kD(Calculated).
Uniprot: P31995
RRID: AB_2837156

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
FCGR2C Antibody detects endogenous levels of total FCGR2C.
RRID:
AB_2837156
Cite Format: Affinity Biosciences Cat# DF4802, RRID:AB_2837156.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD32; CD32A; CD32B; CD32C; CDw32; Fc fragment of IgG low affinity IIa receptor; Fc fragment of IgG low affinity IIa receptor for (CD32); Fc fragment of IgG low affinity IIb receptor; Fc fragment of IgG low affinity IIb receptor for (CD32); Fc fragment of IgG low affinity IIc receptor; Fc fragment of IgG low affinity IIc receptor for (CD32); Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc gamma receptor IIB; Fc gamma receptor IIC; Fc gamma RII a; Fc gamma RII b; Fc gamma RII c; Fc gamma RIIb; Fc gamma RIIc; Fc receptor, IgG, low affinity IIb; Fc-gamma RII-a; Fc-gamma RII-b; Fc-gamma RII-c; Fc-gamma-RIIa; FC-gamma-RIIB; Fc-GAMMA-RIIC; Fc[g]RII; FCG2; FCG2A_HUMAN; FcGR; FCGR2; FCGR2A; FCGR2A1; FCGR2B; FCGR2C; Fcgr3; Fcgr3a; FcgRII; Fcr-2; Fcr-3; FcRII a; FCRII; FcRII b; FcRII c; FcRII-a; FcRIIC; IGFR2; IgG Fc receptor II a; IgG Fc receptor II b; IgG Fc receptor II beta; IgG Fc receptor II c; IgG Fc receptor II-a; IgG Fc receptor II-b; IgG Fc receptor II-c; Immunoglobulin G Fc receptor II; Immunoglobulin G Fc receptor II c; Low affinity immunoglobulin gamma Fc region receptor II; Low affinity immunoglobulin gamma Fc region receptor II-a; Low affinity immunoglobulin gamma Fc region receptor II-b; Low affinity immunoglobulin gamma Fc region receptor II-c; Ly-17; Ly-m20; LyM-1; Lymphocyte antigen 17;

Immunogens

Immunogen:

A synthesized peptide derived from human FCGR2C, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P31995 FCG2C_HUMAN:

Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.

Sequence:
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

Research Backgrounds

Function:

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.

PTMs:

Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK.

Subcellular Location:

Cytoplasm.

Cell membrane>Single-pass type I membrane protein.

Cell membrane>Single-pass type I membrane protein.

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.

Family&Domains:

Contains an intracytoplasmic twice repeated motif referred as immunoreceptor tyrosine-based activator motif (ITAM). These motifs are involved in triggering cell activation upon receptors aggregation.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.