Product: CD63 Antibody
Catalog: AF5117
Description: Rabbit polyclonal antibody to CD63
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 25kDa,47kDa; 26kD(Calculated).
Uniprot: P08962
RRID: AB_2837603

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:1000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CD63 Antibody detects endogenous levels of total CD63.
RRID:
AB_2837603
Cite Format: Affinity Biosciences Cat# AF5117, RRID:AB_2837603.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Lysosomal associated membrane protein 3; CD 63; CD63; CD63 antigen (melanoma 1 antigen); CD63 antigen; CD63 antigen melanoma 1 antigen; CD63 molecule; CD63_HUMAN; gp55; Granulophysin; LAMP 3; LAMP-3; LAMP3; LIMP; Lysosomal-associated membrane protein 3; Lysosome associated membrane glycoprotein 3; Mast cell antigen AD1; ME491; Melanoma 1 antigen; Melanoma associated antigen ME491; Melanoma associated antigen MLA1; Melanoma-associated antigen ME491; MGC72893; MLA 1; MLA1; NGA; Ocular melanoma associated antigen; Ocular melanoma-associated antigen; OMA81H; PTLGP40; Tetraspanin 30; Tetraspanin-30; Tspan 30; Tspan-30; TSPAN30;

Immunogens

Immunogen:

A synthesized peptide derived from human CD63

Uniprot:
Gene(ID):
Expression:
P08962 CD63_HUMAN:

Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages.

Description:
Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGF
Sequence:
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Research Backgrounds

Function:

Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.

PTMs:

Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro).

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Lysosome membrane>Multi-pass membrane protein. Late endosome membrane>Multi-pass membrane protein. Endosome>Multivesicular body. Melanosome. Secreted>Extracellular exosome. Cell surface.
Note: Also found in Weibel-Palade bodies of endothelial cells (PubMed:10793155). Located in platelet dense granules (PubMed:7682577). Detected in a subset of pre-melanosomes. Detected on intralumenal vesicles (ILVs) within multivesicular bodies (PubMed:21962903).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages.

Family&Domains:

Belongs to the tetraspanin (TM4SF) family.

Research Fields

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

References

1). Exosomes-loaded electroconductive nerve dressing for nerve regeneration and pain relief against diabetic peripheral nerve injury. Bioactive Materials, 2023 (PubMed: 36923267) [IF=18.9]

2). Efficient, High-Quality Engineering of Therapeutic Extracellular Vesicles on an Integrated Nanoplatform. ACS nano, 2024 (PubMed: 39450489) [IF=17.1]

3). Glypican-3-targeted macrophages delivering drug-loaded exosomes offer efficient cytotherapy in mouse models of solid tumours. Nature communications, 2024 (PubMed: 39313508) [IF=16.6]

4). Iron Oxide Nanoparticles Engineered Macrophage-Derived Exosomes for Targeted Pathological Angiogenesis Therapy. ACS nano, 2024 (PubMed: 38412252) [IF=15.8]

Application: WB    Species: Mouse    Sample:

Figure 2 Characterization of ESIONPs@EXO derived from ESIONPs engineered macrophages. (A) The morphology of EXO and ESIONPs@EXO determined by TEM. Scale bar: 200 nm (left) and 100 nm (right). (B) The size distribution of EXO and ESIONPs@EXO evaluated by NTA. (C) Western blot analysis of CD9, CD63, CD81, TSG101, and calnexin. (D) Relaxation properties of ESIONPs@EXO. (E) T1 and T2 weighted MR images of ESIONPs@EXO at different concentrations (measured on a 3 T MR scanner). 1/T1 (F) and 1/T2 (G) relaxation rates of ESIONPs@EXO at different concentrations.

5). Endothelium-Derived Engineered Extracellular Vesicles Protect the Pulmonary Endothelial Barrier in Acute Lung Injury. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38062916) [IF=15.1]

6). Intranasal delivery of engineered extracellular vesicles loaded with miR-206-3p antagomir ameliorates Alzheimer's disease phenotypes. Theranostics, 2024 (PubMed: 39659569) [IF=12.4]

7). Exosomal miR-21 from tubular cells contributes to renal fibrosis by activating fibroblasts via targeting PTEN in obstructed kidneys. Theranostics, 2023 (PubMed: 34522205) [IF=12.4]

Application: WB    Species: Mice    Sample: NRK-52E cells

Figure 2 TGF-β1 promotes the secretion of exosomes by renal tubular epithelial cells and activates fibroblasts in vitro. (A) Schematic diagram of experimental process. Exosomes from NRK-52E cells treated without (Ctrl-Exos) or with TGF-β1 (TGFβ1-Exos) were extracted and incubated with NRK-49F cells. (B,C) DLS and NTA of exosomes from NRK-52E cells. (D) TEM image of exosomes isolated from NRK-52E cells. Scale bar = 100 nm. (E, F) Representative western blot (E) and quantitative data (F) of CD63 as an exosome marker in exosomes from TGF-β1- or GW4869-treated NRK-52E cells. Numbers (1 to 3) indicate each independent treatment in the given group. *p < 0.05 versus Ctrl-Exos, #p < 0.05 versus 5 ng/ml TGFβ1-Exos, &p < 0.05 versus 15 ng/ml TGFβ1-Exos (n = 3). (G) Fluorescent staining image of PKH-67-labeled NRK-52E cells. Scales bars=50 μm. (H) Fluorescent staining image of NRK-52E cell-derived exosomes taken up by NRK-49F cells. Scales bars=10 μm. (I, K) Representative western blot (I) and quantitative data (K) of α-SMA and PCNA in NRK-49F cells incubated with exosomes from TGF-β1- or GW4869-treated NRK-52E cells. Numbers (1 to 3) indicate each independent treatment in the giving group. *p < 0.05 versus Ctrl-Exos, #p < 0.05 versus 5 ng/ml TGFβ1-Exos, &p < 0.05 versus 15 ng/ml TGFβ1-Exos (n = 3). (J) Proliferation rate of NRK-49F cells incubated with NRK-52E cell-derived exosomes measured by CCK-8. *p < 0.05 versus Ctrl-Exos, #p < 0.05 versus 5 ng/ml TGFβ1-Exos, &p < 0.05 versus 15 ng/mL TGFβ1-Exos (n = 3). (L-N) Double immunofluorescence staining (green for Col-I and red for fibronectin) demonstrates the expression of Col-I and fibronectin in NRK-49F cells incubated with NRK-52E cell-derived exosomes. Scales bars=50 μm. *p < 0.05 versus Ctrl-Exos, #p < 0.05 versus 5 ng/ml TGFβ1-Exos, &p < 0.05 versus 15 ng/mL TGFβ1-Exos.

8). Small extracellular vesicles encapsulating lefty1 mRNA inhibit hepatic fibrosis. Asian Journal of Pharmaceutical Sciences, 2022 (PubMed: 36382306) [IF=10.7]

9). Regulatory T cell-derived exosome mediated macrophages polarization for osteogenic differentiation in fracture repair. Journal of controlled release : official journal of the Controlled Release Society, 2024 (PubMed: 38508525) [IF=10.5]

10). Peripheral nerves modulate the peri-implant osteogenesis under type 2 diabetes through exosomes derived from schwann cells via miR-15b-5p/Txnip signaling axis. Journal of nanobiotechnology, 2025 (PubMed: 39875954) [IF=10.2]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.