Product: Twist1 Antibody
Catalog: AF5224
Description: Rabbit polyclonal antibody to Twist1
Application: WB
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Chicken
Mol.Wt.: 20 kDa; 21kD(Calculated).
Uniprot: Q15672
RRID: AB_2837710

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
Twist1 Antibody detects endogenous levels of total Twist1.
RRID:
AB_2837710
Cite Format: Affinity Biosciences Cat# AF5224, RRID:AB_2837710.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ACS3; B-HLH DNA binding protein; bHLHa38; BPES2; BPES3; Class A basic helix-loop-helix protein 38; CRS; CRS1; CSO; H-twist; OTTHUMP00000116043; SCS; TWIST; Twist basic helix loop helix transcription factor 1; Twist family bHLH transcription factor 1; Twist homolog 1 (Drosophila); Twist homolog 1; TWIST homolog of drosophila; Twist related protein 1; Twist-related protein 1; TWIST1; TWST1_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human Twist1, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q15672 TWST1_HUMAN:

Subset of mesodermal cells.

Description:
Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of proinflammatory cytokines such as TNFA and IL1B
Sequence:
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Chicken
100
Horse
0
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Regulates cranial suture patterning and fusion. Activates transcription as a heterodimer with E proteins. Regulates gene expression differentially, depending on dimer composition. Homodimers induce expression of FGFR2 and POSTN while heterodimers repress FGFR2 and POSTN expression and induce THBS1 expression. Heterodimerization is also required for osteoblast differentiation. Represses the activity of the circadian transcriptional activator: NPAS2-ARNTL/BMAL1 heterodimer (By similarity).

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Subset of mesodermal cells.

Research Fields

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

References

1). Noncanonical TGF-β signaling leads to FBXO3-mediated degradation of ΔNp63α promoting breast cancer metastasis and poor clinical prognosis. PLOS Biology, 2023 (PubMed: 33626035) [IF=7.8]

Application: WB    Species: Human    Sample: MCF-10A cells

Fig 1 TGF-β1 promotes cell motility via accelerated ΔNp63α proteasomal degradation independent of Smad pathway. (A) MCF-10A cells were infected with lentivirus expressing ΔNp63α or a vector control and were selected for drug resistance. The stable cells were then treated with vehicle or TGF-β1 (10 ng/mL) for 48 h or 72 h prior to examination of cell morphology. Representative images were shown. Scale bar = 100 μm. (B, C) MCF-10A cells were treated with an indicated dose of TGF-β1 for 12 h or were treated with 10 ng/ml TGF-β1 for an indicated time, followed by western blot analyses. (D–G) MCF-10A cells stably expressing HA-TβRI were infected with lentivirus expressing Flag-ΔNp63α or a vector control, followed by (D) western blot analyses, (E) morphology assays, or (F, G) transwell assays. Data from 3 independent experiments in triplicates were presented as means ± SD. Scale bar = 100 μm. ***p < 0.001. (H) MCF-10A cells were grown in the presence of 10 ng/ml TGF-β1 for 36 h and then treated with 10 μM phosphorylated Smad3 inhibitor SIS3 for 8 h prior to western blot analyses. (I) MCF-10A stable cells expressing HA-TβRI were infected with lentivirus expressing HA-Smad7 or a vector control, followed by western blot analyses. (J) MCF-10A cells were grown in the presence of 10 ng/ml TGF-β1 for 36 h and then treated with 10 μM MEK inhibitor U0126 for 10 h prior to western blot analyses. (K) MCF-10A cells stably expressing HA-TβRI were treated with CHX (50 μg/mL) for an indicated time interval and then subjected to western blot analyses. The ΔNp63α protein levels were quantified and presented. (L) MCF-10A cells were grown in the presence of 10 ng/ml TGF-β1 for 36 h and then treated with 10 μM MG132 for 6 h or 45 μM CLQ for 12 h prior to western blot analyses. The underlying data for this figure can be found in S1 Data. CHX, cycloheximide; CLQ, chloroquine; TGF-β, transforming growth factor-β.

2). FBXO3 stabilizes USP4 and Twist1 to promote PI3K-mediated breast cancer metastasis. PLoS biology, 2023 (PubMed: 38134227) [IF=7.8]

Application: WB    Species: Human    Sample: MDA-MB-231 and Hs578T cells

Fig 2. FBXO3 promotes cell migration and tumor metastasis via up-regulation of Twist1 expression. (A) MDA-MB-231 or Hs578T cells stably expressing shFBXO3-#1, shFBXO3-#2, or shGFP (-) were subjected to western blot analyses. (B) MDA-MB-231 or MCF-10A cells stably expressing HA-FBXO3 WT, HA-FBXO3ΔF (ΔF), or a vector control (-) were subjected to western blot analyses. (C) MDA-MB-231 cells stably expressing HA-FBXO3 were infected with a recombinant lentivirus expressing specific shRNA targeting to Twist1 or a vector control (-), and were subjected to western blot analyses. (D) MDA-MB-231 stable cells were subjected to transwell assays. Data from 3 independent experiments were presented as means ± SD. ***p < 0.001. Scale bar = 100 μm. (E–G) MDA-MB-231 stable cells were subjected to tail vein injection in BALB/c nude mice (n = 5). Lungs of mice were photographed (E) and stained with HE staining (F), and the number of tumors per mouse was counted (G). Data were presented as means ± SEM. *p < 0.05. (H, I) Consecutive TMA slides derived from human breast cancer specimens (HBreD030PG03, OUTDO, Shanghai, China) were subjected to IHC for expression of FBXO3 and Twist1. IHC staining was quantified by AOD. Representative images of IHC staining and Pearson correlation of FBXO3 and Twist1 expression were shown. Scale bar = 100 μm. The data underlying the graphs shown in the figure can be found in S1 Data. AOD, average optical density; IHC, immunohistochemistry; TMA, tissue microarray; WT, wild-type.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.