Product: MMP9 Antibody
Catalog: AF5228
Description: Rabbit polyclonal antibody to MMP9
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Horse
Mol.Wt.: 78kD(active), 92-105kD(Pro); 78kD(Calculated).
Uniprot: P14780
RRID: AB_2837714

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(82%), Horse(82%)
Clonality:
Polyclonal
Specificity:
MMP9 Antibody detects endogenous levels of total MMP9.
RRID:
AB_2837714
Cite Format: Affinity Biosciences Cat# AF5228, RRID:AB_2837714.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase Type 4 beta; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GelatinaseB; GELB; Macrophage gelatinase; MANDP2; Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); Matrix Metalloproteinase 9; MMP 9; MMP-9; MMP9; MMP9_HUMAN; Type V collagenase;

Immunogens

Immunogen:

A synthesized peptide derived from human MMP9, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P14780 MMP9_HUMAN:

Detected in neutrophils (at protein level) (PubMed:7683678). Produced by normal alveolar macrophages and granulocytes.

Description:
May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-
Sequence:
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
82
Horse
82
Bovine
73
Dog
73
Rabbit
64
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.

PTMs:

Processing of the precursor yields different active forms of 64, 67 and 82 kDa. Sequentially processing by MMP3 yields the 82 kDa matrix metalloproteinase-9.

N- and O-glycosylated.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in neutrophils (at protein level). Produced by normal alveolar macrophages and granulocytes.

Family&Domains:

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Belongs to the peptidase M10A family.

Research Fields

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). Downregulated cytotoxic CD8+ T-cell identifies with the NKG2A-soluble HLA-E axis as a predictive biomarker and potential therapeutic target in keloids. Cellular & molecular immunology, 2022 (PubMed: 35039632) [IF=21.8]

Application: WB    Species: Human    Sample: fibroblasts

Fig. 6 Abnormal expression of human leucocyte antigen-E (HLA-E) is involved in keloids. A–C By using opal multicolor immunohistochemistry (IHC), nuclei (DAPI), CD56, CD3, HLA-E, and vimentin were stained to identify NK cells and HLA-E expression in A skin, B normal scar, and C keloid tissues. The ratio of D CD3−CD56+/CD3 cells was significantly higher in keloids. E Western blot analysis (MMP9 and HLA-E) of fibroblasts from skin, normal scar and keloid tissues, and the expression was analyzed (F, G). H Serum samples (36 healthy donors vs. 34 keloid patients without any treatments or diseases) showed increased soluble HLA-E (sHLA-E) levels in the keloid patients. I The serum samples of 16 keloid patients followed over time showed that sHLA-E was significantly decreased after 3 rounds of triamcinolone+5-FU intralesional therapy. HD: healthy donor; NTK: nontreated keloid; TK: treated keloid; ns: no significant difference; **P 

2). CRSP8 promotes thyroid cancer progression by antagonizing IKKα-induced cell differentiation. Cell Death & Differentiation, 2020 (PubMed: 33162555) [IF=13.7]

Application: WB    Species: Human    Sample: thyroid cancer cells

Fig. 3 Regulation of CRSP8 on migration, invasion, and apoptosis of thyroid cancer cells. A Cell migration and B cell invasion were analyzed in thyroid cancer cells transfected with CRSP8 specific siRNAs or its overexpression plasmids, and the relative rate of migration was calculated, the number of invading cells was counted. C Western blot analysis of the expression of MMP-9, EMT markers (E-cadherin, N-cadherin, β-catenin, Vimentin) in THJ-29T and FTC-133 cells following CRSP8 silencing or overexpression. THJ-21T and THJ-29T cells were treated with CRSP8 specific siRNAs for 48 h, then D FACS analysis and E acridine orange/ethidium bromide fluorescence staining were performed, and the apoptotic cell ratios were counted respectively. F Western blot analysis of the expression of Bcl-2, Bad, Bim, Bax, cleaved caspase-3, and cleaved caspase-9 proteins in thyroid cancer cells following CRSP8 knockdown. The data represent the mean ± SD of at least three independent experiments (four independent experiments in 3D), and the level of significance was indicated by ***P < 0.001.

3). Phenytoin silver: a new nanocompound for promoting dermal wound healing via comprehensive pharmacological action. Theranostics, 2017 (PubMed: 28255340) [IF=12.4]

Application: WB    Species: human    Sample:

Figure 6. PnAg regulates gp130/Jak/Stat3 signaling pathway (A) and (B) NIH-3T3 and HaCat Cells were treated with PnAg at different concentrations and cell viability was tested using MTT analysis. (C) Wound healing assay reflected the effect of PnAg on cell migration. (D) Binding mode of PnAg in the active pocket of gp130. (E) and (F) MMPs activity and expression levels of Stat3, VEGF, TGFB-1, and TGFB1 detected using zymographic and Western blot assays. (G) Diagram of the proposed function of PnAg in wound inflammation and re-epithelialization controls.

Application: IHC    Species: human    Sample:

Figure 2. PnAg promotes wound healing in SD rats. (A) Photographs of rat skin full-thickness excision wounds on different post-excision days. (B) Change in wound areas of SD rats after treatment; (C) and (D) Expression levels of collagen I, NF-κB, TGF-ß, MMP-2, and MMP-9 in tissues on day 7 and 17 detected by immunohistochemistry. (E) Histogram of protein expression levels in these tissues. (F) and (G) Histomorphological changes in wound tissues stained by Masson trichrome and HE on day 17.

4). An enzymatic cleavage-triggered minimally invasive nanosensor for urine-based detection of early atherosclerosis. Science advances, 2025 (PubMed: 40085714) [IF=11.7]

Application: WB    Species: Mouse    Sample: aortic tissues

Fig. 5. The PPCs nanosensor enables early AS detection and therapeutic effect monitoring. (A) Timeline for AS modeling and urinary detection using the PPCs nanosensor. (B) Oil Red O staining of aortic tissues in healthy mice (CTRL) and ApoE−/− mice at various time points (n = 3; scale bars, 50 μm). (C to E) Expression levels of MMP-2 and MMP-9 in aortic tissues from healthy mice, ApoE−/− mice, and ApoE−/− mice treated with atorvastatin (n = 3). (F and G) Serum levels of MMP-2 and MMP-9 in healthy mice, ApoE−/− mice, and ApoE−/− mice treated with atorvastatin (n = 10). (H) Representative IF staining images showing MMP-2 (red) and MMP-9 (green) expression in aortic tissues from healthy mice, ApoE−/− mice, and ApoE−/− mice treated with atorvastatin; the nuclei are stained blue with DAPI (n = 3; scale bar, 20 μm). (I to K) Urinary fluorescence intensity of healthy mice, ApoE−/− mice, and ApoE−/− mice treated with atorvastatin after administration of PPCs at 4 to 14 weeks, with (L) corresponding ROC analysis. Data are presented as mean ± SEM (n = 10), with *P < 0.05, **P < 0.01, and ***P < 0.001 compared to CTRL mice, as well as #P < 0.05 and ##P < 0.01 compared to ApoE−/− mice; ns, not significant.

5). Downregulation of castor zinc finger 1 predicts poor prognosis and facilitates hepatocellular carcinoma progression via MAPK/ERK signaling. Journal of Experimental & Clinical Cancer Research, 2018 (PubMed: 29506567) [IF=11.3]

6). Opsonized nanoparticles target and regulate macrophage polarization for osteoarthritis therapy: A trapping strategy. Journal of Controlled Release, 2022 (PubMed: 35489544) [IF=10.5]

7). A bone-targeting near-infrared luminescence nanocarrier facilitates alpha-ketoglutarate efficacy enhancement for osteoporosis therapy. Acta biomaterialia, 2024 (PubMed: 37984632) [IF=9.4]

8). Echinatin inhibits the growth and metastasis of human osteosarcoma cells through Wnt/β-catenin and p38 signaling pathways. Pharmacological Research, 2023 (PubMed: 37023991) [IF=9.1]

Application: WB    Species: Human    Sample: OS cells

Fig. 4. Ecn inhibits the migration and invasion of OS cells. (A) The effect of Ecn on the migration of OS cells (Wound healing assay, 100 ×). (B) The effect of Ecn on the migration of OS cells (Transwell assay, 100 ×). (C) The effect of Ecn on the invasion of OS cells (Matrigel-coated Transwell assay, 100 ×). (D) The effect of Ecn on the protein level of MMP2, MMP7, MMP9, Snail, Vimentin, N-Cadherin and E-Cadherin in OS cells (Western blot). ##P 

9). Dihydroartemisinin inhibits the development of colorectal cancer by GSK-3β/TCF7/MMP9 pathway and synergies with capecitabine. Cancer letters, 2024 (PubMed: 38101610) [IF=9.1]

10). The NQO1/PKLR axis promotes lymph node metastasis and breast cancer progression by modulating glycolytic reprogramming. CANCER LETTERS, 2019 (PubMed: 30954648) [IF=9.1]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.