Product: MMP2 Antibody
Catalog: AF5330
Description: Rabbit polyclonal antibody to MMP2
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 74 kDa(Observed); 74kD(Calculated).
Uniprot: P08253
RRID: AB_2837815

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Bovine(100%), Horse(94%), Sheep(100%), Rabbit(89%), Dog(100%)
Clonality:
Polyclonal
Specificity:
MMP2 Antibody detects endogenous levels of total MMP2.
RRID:
AB_2837815
Cite Format: Affinity Biosciences Cat# AF5330, RRID:AB_2837815.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

72 kDa gelatinase; 72kD type IV collagenase; CLG 4; CLG 4A; CLG4; CLG4A; Collagenase Type 4 alpha; Collagenase type IV A; Gelatinase A; Gelatinase alpha; Gelatinase neutrophil; Matrix metallopeptidase 2 gelatinase A 72kDa gelatinase 72kDa type IV collagenase; Matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); Matrix Metalloproteinase 2; Matrix metalloproteinase II; Matrix metalloproteinase-2; MMP 2; MMP II; MMP-2; MMP2; MMP2_HUMAN; MONA; Neutrophil gelatinase; PEX; TBE 1; TBE-1;

Immunogens

Immunogen:

A synthesized peptide derived from human MMP2, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P08253 MMP2_HUMAN:

Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate.

Description:
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture.
Sequence:
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Dog
100
Horse
94
Rabbit
89
Chicken
56
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.

PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels.

Mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro-inflammatory NF-kappaB, NFAT and IRF transcriptional pathways.

PTMs:

Phosphorylation on multiple sites modulates enzymatic activity. Phosphorylated by PKC in vitro.

The propeptide is processed by MMP14 (MT-MMP1) and MMP16 (MT-MMP3). Autocatalytic cleavage in the C-terminal produces the anti-angiogenic peptide, PEX. This processing appears to be facilitated by binding integrinv/beta3.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix. Membrane. Nucleus.
Note: Colocalizes with integrin alphaV/beta3 at the membrane surface in angiogenic blood vessels and melanomas. Found in mitochondria, along microfibrils, and in nuclei of cardiomyocytes.

Cytoplasm. Mitochondrion.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate.

Family&Domains:

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Belongs to the peptidase M10A family.

Research Fields

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). Phenytoin silver: a new nanocompound for promoting dermal wound healing via comprehensive pharmacological action. Theranostics, 2017 (PubMed: 28255340) [IF=12.4]

Application: WB    Species: human    Sample:

Figure 6. PnAg regulates gp130/Jak/Stat3 signaling pathway (A) and (B) NIH-3T3 and HaCat Cells were treated with PnAg at different concentrations and cell viability was tested using MTT analysis. (C) Wound healing assay reflected the effect of PnAg on cell migration. (D) Binding mode of PnAg in the active pocket of gp130. (E) and (F) MMPs activity and expression levels of Stat3, VEGF, TGFB-1, and TGFB1 detected using zymographic and Western blot assays. (G) Diagram of the proposed function of PnAg in wound inflammation and re-epithelialization controls.

Application: IHC    Species: human    Sample:

Figure 2. PnAg promotes wound healing in SD rats. (A) Photographs of rat skin full-thickness excision wounds on different post-excision days. (B) Change in wound areas of SD rats after treatment; (C) and (D) Expression levels of collagen I, NF-κB, TGF-ß, MMP-2, and MMP-9 in tissues on day 7 and 17 detected by immunohistochemistry. (E) Histogram of protein expression levels in these tissues. (F) and (G) Histomorphological changes in wound tissues stained by Masson trichrome and HE on day 17.

2). An enzymatic cleavage-triggered minimally invasive nanosensor for urine-based detection of early atherosclerosis. Science advances, 2025 (PubMed: 40085714) [IF=11.7]

Application: WB    Species: Mouse    Sample: aortic tissues

Fig. 5. The PPCs nanosensor enables early AS detection and therapeutic effect monitoring. (A) Timeline for AS modeling and urinary detection using the PPCs nanosensor. (B) Oil Red O staining of aortic tissues in healthy mice (CTRL) and ApoE−/− mice at various time points (n = 3; scale bars, 50 μm). (C to E) Expression levels of MMP-2 and MMP-9 in aortic tissues from healthy mice, ApoE−/− mice, and ApoE−/− mice treated with atorvastatin (n = 3). (F and G) Serum levels of MMP-2 and MMP-9 in healthy mice, ApoE−/− mice, and ApoE−/− mice treated with atorvastatin (n = 10). (H) Representative IF staining images showing MMP-2 (red) and MMP-9 (green) expression in aortic tissues from healthy mice, ApoE−/− mice, and ApoE−/− mice treated with atorvastatin; the nuclei are stained blue with DAPI (n = 3; scale bar, 20 μm). (I to K) Urinary fluorescence intensity of healthy mice, ApoE−/− mice, and ApoE−/− mice treated with atorvastatin after administration of PPCs at 4 to 14 weeks, with (L) corresponding ROC analysis. Data are presented as mean ± SEM (n = 10), with *P < 0.05, **P < 0.01, and ***P < 0.001 compared to CTRL mice, as well as #P < 0.05 and ##P < 0.01 compared to ApoE−/− mice; ns, not significant.

3). Downregulation of castor zinc finger 1 predicts poor prognosis and facilitates hepatocellular carcinoma progression via MAPK/ERK signaling. Journal of Experimental & Clinical Cancer Research, 2018 (PubMed: 29506567) [IF=11.3]

4). Dual-responsive renal injury cells targeting nanoparticles for vitamin E delivery to treat ischemia reperfusion-induced acute kidney injury. Journal of nanobiotechnology, 2024 (PubMed: 39407248) [IF=10.2]

Application: IF/ICC    Species: Human    Sample: HK-2 cells

Fig. 3. Biocompatibility, Cellular Uptake, and Targeted Ability of NPs Fig. 3. Biocompatibility, Cellular Uptake, and Targeted Ability of NPs. A. The dose-dependent cytotoxicity tests of NPs on HK-2 cells in vitro. B. The time-dependent cytotoxicity tests of NPs on HK-2 cells in vitro. C. The in vitro drug release curves of the NPs. D. Representative confocal microscopy images of MMP2 and FITC-VitE in HK-2 cells, scale bar = 10 μm. Results are presented as means ± SEM, n = 6. P values from One-way ANOVA with Dunnett’s multiple comparisons test

5). The NQO1/PKLR axis promotes lymph node metastasis and breast cancer progression by modulating glycolytic reprogramming. CANCER LETTERS, 2019 (PubMed: 30954648) [IF=9.1]

Application: WB    Species: mouse    Sample: NQO1 cells

Figure 3| NQO1 promotes cellular invasion, metastasis and the EMT in vitro and in vivo.

Application: WB    Species: mouse    Sample: NQO1 cells

Figure 3| NQO1 promotes cellular invasion, metastasis and the EMT in vitro and in vivo.F: The expression of epithelial markers (E-cadherin and ZO-1) and mesenchymal markers (Vimentin, Snail, Slug, Twist and MMP-2) was determined by western blot analysis. β-Actin was used as a loading control.

6). Quercetin-loaded exosomes delivery system prevents myopia progression by targeting endoplasmic reticulum stress and ferroptosis in scleral fibroblasts. Materials today. Bio, 2025 (PubMed: 40520556) [IF=8.7]

Application: WB    Species: human    Sample: scleral tissue

Fig. 6. The elimination of ER stress and ferroptosis alleviates scleral ECM remodeling. (A, B) Transmission electron microscopy images of collagen fibers in scleral tissue at 2 and 4 weeks (n = 3); (C, D) Representative proteins expression of TGF-β1, MMP2 and a-SMA in sclera tissue (n = 3); (E) Schematic illustration of ECM remodeling during myopia progression.

7). Foxq1 promotes metastasis of nasopharyngeal carcinoma by inducing vasculogenic mimicry via the EGFR signaling pathway. Cell Death & Disease, 2021 (PubMed: 33875643) [IF=8.1]

Application: WB    Species: mouse    Sample: tumors

Fig. 5 |Foxq1 promotes VM formation, and NPC growth and metastasis through regulating EGFR in vivo.H Metastatic nodules by tail vein injection of each group and normal lung (left). Image of H&E staining of lung sections from each group (right); Scale bars represent 500 μm. I Statistical results of the metastatic nodules in each group; p < 0.001. The expression of related genes in xenograft tumors from each group were monitored by qRT-PCR (J)and western blot (K). Data are presented as mean ± SD of three independent experiments.

Application: IF/ICC    Species: mouse    Sample: 5–8F cells

Fig. 7| MiR-124 inhibits the EGFR signaling pathway and VM formation, that could be rescued by Foxq1 expression. E Immunofluorescence staining of Foxq1, EGFR, VE-cadherin, MMP2 and MMP9 in 5–8F cells that overexpressed miR-124, control or simultaneously Foxq1 and miR-124, respectively; scale bars represent 50μm. qRT-PCR (F) and western blot (G) were used to monitor the expression of EGFR signaling pathway and VM-related genes in 5–8F cells that overexpressed miR-124, control or simultaneously Foxq1 and miR-124, respectively.Data are presented as mean ± SD of three independent experiments.

8). Targeting the MDK/c-Myc complex to overcome temozolomide resistance in glioma. Clinical and translational medicine, 2025 (PubMed: 40468625) [IF=7.9]

Application: WB    Species: Mouse    Sample:

FIGURE 4 MDK affects the ubiquitination modification of c-Myc and the Wnt/β-catenin signalling pathway. (A–C) Results from proteomic analysis indicated that MDK affected the Wnt/β-catenin signalling pathway and protein ubiquitination. The raw data are shown in Table S8. (A) Volcano plot analysis results showed differentially expressed proteins (Table S9). The red dots represent upregulated expression in the siMDK group compared with the control group, and the yellow dots represent downregulated expression in the siMDK group compared with the control group. (B) Cluster analysis results showed similarities and differences among the groups (control vs. siMDK) and the stability of the mass spectrometry results of the three repeated experiments (Table S10). (C) KEGG pathway enrichment analysis revealed the signalling pathway affected by MDK knockdown (Table S11). (D) After treatment with 10 mM MG132 for 4 h, siMDK-U118MG and siMDK-SF126 cell lysates were immunoprecipitated with c-Myc and immunoblotted with ubiquitination antibodies. (E) After treatment with 10 mM MG132 for 4 h, OE-MDK-SHG44 and OE-MDK-U87 cell lysates were immunoprecipitated with c-Myc and immunoblotted with ubiquitination antibodies. (F–G) 50 mg/mL cycloheximide was added (at different time points: 0, 2, 4, 6, and 8 h) to glioma cells transfected with siRNA to block protein synthesis. The expression of c-Myc was then detected by Western blot. (H) MDK knockdown was performed on SF126, U118MG, and U251, and then a Western blot was used to detect the Wnt/β-catenin signalling pathway and EMT pathway markers. (I) MDK was overexpressed in U87, BT325, and SHG44, and Western blot was used to detect the Wnt/β-catenin signalling pathway and EMT pathway markers.

9). TRIML2 promotes malignant progression of head and neck squamous cell carcinoma via canonical Wnt signaling and tumor immune escape. Journal of Translational Medicine, 2025 [IF=7.5]

Application: WB    Species: human    Sample: HNSC cells

Fig. 8 TRIML2 knockdown inhibits the proliferation, migration, and invasion of HNSC cells. (A, B) Western blot and RT-qPCR were used to validate the knockdown efficiency of TRIML2 in HNSC cell lines. (C-F) The proliferative ability was assessed by CCK-8 and EdU assays. (G-H) Migration and invasion ability were measured by wound-healing and transwell assays. (I) the canonical wnt and EMT-related proteins were detected by Western blot after TRIML2 knockdown. All in vitro experiments were performed in at least three independent replicates. The data are presented as the mean ± SD.

10). Hypertriglyceridemia Does Not Worsen Thoracic Aortic Aneurysm and Dissection in GPIHBP1 Knockout Mice. Arteriosclerosis, thrombosis, and vascular biology, 2026 (PubMed: 41853866) [IF=7.4]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.