Product: Desmin Antibody
Catalog: AF5334
Description: Rabbit polyclonal antibody to Desmin
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 52 kDa(Observed); 54kD(Calculated).
Uniprot: P17661
RRID: AB_2837819

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat, Monkey
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
Desmin Antibody detects endogenous levels of total Desmin.
RRID:
AB_2837819
Cite Format: Affinity Biosciences Cat# AF5334, RRID:AB_2837819.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CMD1I; CSM1; CSM2; DES; DESM_HUMAN; Desmin; FLJ12025; FLJ39719; FLJ41013; FLJ41793; Intermediate filament protein; OTTHUMP00000064865;

Immunogens

Immunogen:

A synthesized peptide derived from human Desmin, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
Desmin are class-III intermediate filaments found in muscle cells. In adult striated muscle they form a fibrous network connecting myofibrils to each other and to the plasma membrane from the periphery of the Z-line structures.
Sequence:
MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Chicken
100
Rabbit
100
Xenopus
92
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Muscle-specific type III intermediate filament essential for proper muscular structure and function. Plays a crucial role in maintaining the structure of sarcomeres, inter-connecting the Z-disks and forming the myofibrils, linking them not only to the sarcolemmal cytoskeleton, but also to the nucleus and mitochondria, thus providing strength for the muscle fiber during activity. In adult striated muscle they form a fibrous network connecting myofibrils to each other and to the plasma membrane from the periphery of the Z-line structures. May act as a sarcomeric microtubule-anchoring protein: specifically associates with detyrosinated tubulin-alpha chains, leading to buckled microtubules and mechanical resistance to contraction. Contributes to the transcriptional regulation of the NKX2-5 gene in cardiac progenitor cells during a short period of cardiomyogenesis and in cardiac side population stem cells in the adult. Plays a role in maintaining an optimal conformation of nebulette (NEB) on heart muscle sarcomeres to bind and recruit cardiac alpha-actin (By similarity).

PTMs:

ADP-ribosylation prevents ability to form intermediate filaments.

Phosphorylation at Ser-7, Ser-28 and Ser-32 by CDK1, phosphorylation at Ser-60 by AURKB and phosphorylation at Thr-76 by ROCK1 contribute to efficient separation of desmin intermediate filaments during mitosis.

Subcellular Location:

Cytoplasm>Myofibril>Sarcomere>Z line. Cytoplasm. Cell membrane>Sarcolemma. Nucleus.
Note: Localizes in the intercalated disks which occur at the Z line of cardiomyocytes (PubMed:24200904, PubMed:26724190). Localizes in the nucleus exclusively in differentiating cardiac progenitor cells and premature cardiomyocytes (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the intermediate filament family.

Research Fields

· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).

· Human Diseases > Cardiovascular diseases > Arrhythmogenic right ventricular cardiomyopathy (ARVC).

· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).

References

1). Human umbilical cord mesenchymal stem cells ameliorate erectile dysfunction in rats with diabetes mellitus through the attenuation of ferroptosis. Stem Cell Research & Therapy, 2022 (PubMed: 36064453) [IF=7.5]

2). Cuproptosis, a potential target for the therapy of diabetic critical limb ischemia. Free radical biology & medicine, 2025 (PubMed: 40246253) [IF=7.1]

3). Satellite cell-derived exosome-mediated delivery of microRNA-23a/27a/26a cluster ameliorates the renal tubulointerstitial fibrosis in mouse diabetic nephropathy. Acta Pharmacologica Sinica, 2023 (PubMed: 37596398) [IF=6.9]

4). Exosomes derived from smooth muscle cells ameliorate diabetes‐induced erectile dysfunction by inhibiting fibrosis and modulating the NO/cGMP pathway. Journal of Cellular and Molecular Medicine, 2020 (PubMed: 33009701) [IF=5.3]

Application: IF/ICC    Species: rat    Sample: CCSMCs

FIGURE 1 |Cell identification and exosome characterization. (C) Representative immunofluorescence results of CCSMCs show positive expression for α-SMA and desmin. Scale bars = 50 μm

5). Bi-phasic effect of gelatin in myogenesis and skeletal muscle regeneration. Disease Models & Mechanisms, 2021 (PubMed: 34821368) [IF=4.0]

6). The potential role of differentially expressed tRNA-derived fragments in high glucose-induced podocytes. Renal failure, 2024 (PubMed: 38369750) [IF=3.0]

Application: WB    Species: Mouse    Sample:

Figure 1. Construction of the podocyte injury model. (A) RT-qPCR was used to measure the mRNA expression levels of nephrin, podocin and desmin in mouse podocytes in the control, HG, and mannitol groups. (B) Protein expression levels of related indexes in cells were assessed by western blotting. The data are expressed as the mean ± SD. *p < .05, ***p < .001 vs. the control group. NS: not significant; HG: high glucose; RT-qPCR: real-time quantitative polymerase chain reaction.

7). Integrated Network Pharmacology and Cellular Assay to Explore the Mechanisms of Selenized Tripterine Phytosomes (Se@Tri-PTs) Alleviating Podocyte Injury in Diabetic Nephropathy. Current pharmaceutical design, 2023 (PubMed: 37961864) [IF=2.6]

Application: WB    Species: Mouse    Sample: podocytes

Fig. (7). Expressions of nephrin and desmin in podocytes treated for 48 h and quantified by western blot. **P < 0.01, compared to the NG group. Abbreviations: NG, normal glucose; DM, D-mannitol (30 mmol/L); HG, high glucose (30 mmol/L). (A higher resolution/colour version of this figure is available in the electronic copy of the article).

8). Berberine and Glycyrrhizic Acid Co-Assembled Nanoparticles Mitigate Podocyte Injury Via Suppressing Ferroptosis. , 2024

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.