Product: NPY Antibody
Catalog: DF6431
Description: Rabbit polyclonal antibody to NPY
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 11kDa(Observed); 11kD(Calculated).
Uniprot: P01303
RRID: AB_2838394

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Zebrafish(%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
NPY Antibody detects endogenous levels of total NPY.
RRID:
AB_2838394
Cite Format: Affinity Biosciences Cat# DF6431, RRID:AB_2838394.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C-flanking peptide of NPY; CPON; Neuropeptide tyrosine; Neuropeptide Y precursor; NPY; NPY_HUMAN; Pro neuropeptide Y; PYY 4; PYY4; Y Neuropeptide;

Immunogens

Immunogen:

A synthesized peptide derived from human NPY, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P01303 NPY_HUMAN:

One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.

Description:
The NPY hormone family consists of NPY, PP and peptide YY. NPY (neuropeptide Y) is a 36 amino acid protein that consists of a polyproline stretch followed by an amphipathic a-helix. NPY shares a 50% amino acid homology with pancreatic polypeptide gene (PP). NPY is expressed throughout the central and peripheral nervous system, particularly in the deep layers of the cortex and smaller cell bodies in the white matter. NPY interacts with the Y-receptor family of G protein-coupled receptors. NPY interacts with NPY receptor Y1 to increase corticotropin levels and decrease noradrenaline levels in the hypothalamus. Through interactions in the hypothalus, NPY plays important roles in the regulation of energy balance by stimulating food intake. NPY favors energy storage by increasing lipoprotein lipase activity in white adipose tissue. A Leucine 7 to Proline 7 polymorphism has been implicated in an increase in alcohol preference, and decrease in cholesterol metabolism.
Sequence:
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

PTMs:

The neuropeptide Y form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro).

Subcellular Location:

Secreted. Cytoplasmic vesicle>Secretory vesicle>Neuronal dense core vesicle.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.

Family&Domains:

Belongs to the NPY family.

Research Fields

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Human Diseases > Substance dependence > Alcoholism.

· Organismal Systems > Endocrine system > Adipocytokine signaling pathway.

· Organismal Systems > Endocrine system > Regulation of lipolysis in adipocytes.

References

1). Peripheral nerves modulate the peri-implant osteogenesis under type 2 diabetes through exosomes derived from schwann cells via miR-15b-5p/Txnip signaling axis. Journal of nanobiotechnology, 2025 (PubMed: 39875954) [IF=10.2]

Application: IHC    Species: rat    Sample:

Fig. 1 Peri-implant peripheral nerves. (A) NF histological examination of nerve fibers in the peri-implant bone revealed distinct patterns in the Control and T2DM groups. Representative images illustrate nerve fibers mainly distributed perivascularly and within bone tissue and a higher number of nerves around dental implants in the Control group compared to the T2DM group, where implants were often enveloped by connective tissue. (B) NPY histological analysis of nerve fibers in the peri-implant bone showed distinct differences between the Control and T2DM groups. Representative images demonstrated that nerve fibers were primarily located around blood vessels and within the bone tissue. The Control group exhibited a greater density of nerve fibers around dental implants compared to the T2DM group. (C) Nerve positive rate in the Control group was 80% which is significantly higher than the T2DM group’s 20%. (D) Immunofluorescence staining for CD63 in peri-implant bone tissue demonstrated the expression of CD63, a marker for exosomes. Notably, CD63 expression was observed in GFAP-positive cells, indicating that SCs were actively secreting exosomes in the peri-implant bone. T2DM: Type 2 diabetes mellitus, NF: Neurofilament, NPY: Neuropeptide Y, GFAP: glial fibrillary acidic protein, SCs: Schwann cells. *p 

2). Targeted muscle reinnervation attenuates neuropathic pain and neuroma development in a rat model of tibial nerve transection. Frontiers in bioengineering and biotechnology, 2026 (PubMed: 41836766) [IF=4.3]

3). Metabolic regulation of Ganoderma lucidum extracts in high sugar and fat diet-induced obese mice by regulating the gut-brain axis. Journal of Functional Foods, 2020 [IF=3.8]

4). Neuropeptide Y upregulates Runx2 and osterix and enhances osteogenesis in mouse MC3T3‑E1 cells via an autocrine mechanism. Molecular medicine reports, 2020 (PubMed: 33000198) [IF=3.4]

Application: WB    Species: Mouse    Sample:

Figure 1. - Expression of NPY mRNA and protein in MC3T3-E1 cells. (A) Effects of siRNA inhibition on the expression of NPY mRNA at 48 h. **P

5). Chronic heat stress alters hypothalamus integrity, the serum indexes and attenuates expressions of hypothalamic appetite genes in broilers. Journal of Thermal Biology, 2019 (PubMed: 30975407) [IF=2.9]

Application: IF/ICC    Species: broilers    Sample: hypothalamus

Fig. 5. |Effect of chronic heat stress on protein levels of NPY in the hypothalamus of broilers after 14 days heat stress based on the whole-brain immunofluorescent method of the control group (A), heat stress group (B), pair-fed group (C). NPY, neuropeptide Y. White arrows on the right row panels indicates NPY proteins which colors are red.

6). Electroacupuncture alleviates Parkinson disease and regulates the expression of brain-gut peptides. EXPERIMENTAL ANIMALS, 2020 (PubMed: 32669479) [IF=2.2]

Application: WB    Species: rat    Sample: brain

Fig. 5.| Effects of EA on the levels of brain-gut peptides. A. The expression of NPY, CCK, and SST in the brain substantia nigra of rats from NC group, Sham group, 6-OHDA group, and 6-OHDA+EA group was determined by Western blot. B. The levels of NPY,CCK, SST, MTL, GAS, and PYY in the serum of rats from each group were detected by ELSA. Data are expressed as mean ±SD. *P<0.05, **P<0.01.

7). 交泰丸含药血清通过激活SIRT1 抑制内质网应激改善高糖高脂对SH-SY5Y 细胞的损伤. 神经药理学报, 2024

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.