Product: HSD3B2 Antibody
Catalog: DF6639
Description: Rabbit polyclonal antibody to HSD3B2
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat, Duck
Prediction: Horse
Mol.Wt.: 42kDa; 42kD(Calculated).
Uniprot: P26439
RRID: AB_2838601

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Duck
Prediction:
Horse(86%)
Clonality:
Polyclonal
Specificity:
HSD3B2 Antibody detects endogenous levels of total HSD3B2.
RRID:
AB_2838601
Cite Format: Affinity Biosciences Cat# DF6639, RRID:AB_2838601.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

3 beta HSD adrenal and gonadal type; 3 beta HSD II; 3 beta HSD type II; 3 beta hydroxy 5 ene steroid dehydrogenase; 3 beta hydroxy Delta(5) steroid dehydrogenase; 3 beta hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase type II, delta 5-delta 4-isomerase type II, 3 beta-HSD type II; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3-beta-HSD II; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; 3BHS2_HUMAN; ADRENAL HYPERPLASIA II; beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; delta 5 delta 4 isomerase type II; Delta-5-3-ketosteroid isomerase; HSD3B; HSD3B2; HSDB; HSDB3B; hydroxy delta 5 steroid dehydrogenase, 3 beta and steroid delta isomerase 2; Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; Progesterone reductase; SDR11E2; short chain dehydrogenase/reductase family 11E, member 2; Steroid Delta-isomerase;

Immunogens

Immunogen:

A synthesized peptide derived from human HSD3B2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P26439 3BHS2_HUMAN:

Expressed in adrenal gland, testis and ovary.

Description:
The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene.
Sequence:
MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
86
Dog
71
Pig
0
Bovine
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Subcellular Location:

Endoplasmic reticulum membrane>Single-pass membrane protein. Mitochondrion membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in adrenal gland, testis and ovary.

Family&Domains:

Belongs to the 3-beta-HSD family.

Research Fields

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Endocrine system > Ovarian steroidogenesis.

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

References

1). Naringenin improves ovarian health by reducing the serum androgen and eliminating follicular cysts in letrozole-induced polycystic ovary syndrome in the Sprague Dawley rats. Phytotherapy research : PTR, 2023 (PubMed: 37165686) [IF=6.1]

2). P407 hydrogel loaded with nitric oxide microbubbles promotes angiogenesis and functional improvement in testicular transplantation. Biomaterials science, 2024 (PubMed: 38196338) [IF=5.8]

3). A novel method to improve sow reproductive performance: Combination of pre-weaning immunization against inhibin and post-insemination hCG treatment. Journal of Integrative Agriculture, 2020 [IF=4.6]

4). The Abscopal Effects of Cranial Irradiation Induce Testicular Damage in Mice. Frontiers in physiology, 2021 (PubMed: 34867437) [IF=4.0]

Application: IF/ICC    Species: Mouse    Sample:

FIGURE 4. The abscopal effects of C-irradiation affect the secretory functions of the testis. (A) Serum T concentrations secreted by Leydig cells, n=7 for each group. (B–C) Immunofluorescence of 3βHSD in testis and average fluorescence intensity from 10 random fields for each group. Bar=100μm. (D–E) GDNF and SCF concentrations secreted by Sertoli cells and detected by ELISA, n=5 for each group. (F) Typical immunoblots relating to the secretory functions of Sertoli cells. The first two bands were from the same membrane and the last two bands were from another membrane. (G–H) Relative protein level of GDNF and SCF detected by Western blotting, n=4 for each group. The values are expressed as the mean±SD and analysed by two-tailed unpaired student’s t-tests. ** p

5). Effects of stocking density on ovarian development and maturation during the rearing period in Shan-ma ducks. POULTRY SCIENCE, 2022 (PubMed: 35358924) [IF=3.8]

Application: WB    Species: Shan-maducks    Sample: ovarian

Figure 5.| Effects of stocking densities on protein levels of the ovarian steroid biosynthesis pathway. The protein expression levels of CYP19A1,3b-HSD, and StAR in ovarian tissue. Data are presented as the mean § SEM, n = 6. Adjacent letters indicate significant differences (P < 0.05) and interphase letters indicate extremely significant differences (P < 0.01).

6). Hyperbaric oxygen preconditioning normalizes scrotal temperature, sperm quality, testicular structure, and erectile function in adult male rats subjected to exertional heat injury. Molecular and cellular endocrinology, 2024 (PubMed: 38341020) [IF=3.8]

Application: IF/ICC    Species: Rat    Sample:

Fig. 8. (A) The presence of ZO-1 (green) and claudin-11 (red) in the testes of rats post-EHS, as observed through immunofluorescence microscopy. A comparison is made between the tight junction structures in a normal control testis and those in testes subjected to EHS or HBOP + EHS treatment. (B) An immunohistochemical analysis showing Vimentin (a Sertoli cell marker, red), (C) TGFBR3, and (D) HSD3B (two Leydig cell markers, red) positive cells, colocalizing with TUNEL (an apoptotic marker, green) in the seminiferous tubules of rats. The images also include a merged visualization with DAPI staining (blue). As white arrowheads indicate, the Vimentin+ cells or TGFBR3+ cells or HSD3B+ cells are co-stained with DAPI and TUNEL.

7). Suppression of Notch Signaling Stimulates Progesterone Synthesis by Enhancing the Expression of NR5A2 and NR2F2 in Porcine Granulosa Cells. Genes, 2020 (PubMed: 31978970) [IF=3.5]

Application: WB    Species: porcine    Sample: pGCs

Figure 2.| Effects of DAPT treatment on the expression of proteins involved in steroidogenesis in pGCs. (A) The gene expression of factors involved in cholesterol uptake (LDLR, VLDLR, SRB1, NPC1,SCP2) and progesterone synthesis (StAR, Cyp11a1, HSD3B); (B,C) The protein expression of StAR,Cyp11a1, and HSD3B

8). Prenatal DEHP Exposure Induces Premature Testicular Aging by Promoting Leydig Cell Senescence through the MAPK Signaling Pathways. Advanced biology, 2023 (PubMed: 37246248) [IF=3.2]

9). Disruption of oocyte SUMOylation impacts critical regulatory processes during folliculogenesis in mice. Biology of reproduction, 2025 (PubMed: 39982420) [IF=3.1]

10). Prenatal DEHP exposure induces lifelong testicular toxicity by continuously interfering with steroidogenic gene expression. Translational andrology and urology, 2024 (PubMed: 38590960) [IF=1.9]

Application: WB    Species: Mouse    Sample:

Figure 2. Prenatal DEHP exposure induced immediate testicular injury in the neonatal stage by interfering with steroidogenic gene expression. (A-E) Phenotypes; prenatal DEHP exposure induced immediate testicular injury. (A) Birth weight (n=20); (B) testis weight (n=20); (C) penile length (n=20); (D) AGD (n=20); (E) intratesticular testosterone (n=5). (F-O) Prenatal DEHP exposure interfered with steroidogenic gene expression in the neonatal stage. (F-K) qPCR analysis of Lhcgr, Star, Cyp11a1, Cyp17a1, Hsd3b2, and Hsd17b3 (n=5). (L-O) WB analysis of LHCGR, HSD3B2, and HSD17B3 (n=5). *, P

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.