Product: Osteoprotegerin Antibody
Catalog: DF6824
Description: Rabbit polyclonal antibody to Osteoprotegerin
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 45~60kDa(Observed); 46kD(Calculated).
Uniprot: O00300
RRID: AB_2838784

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
Osteoprotegerin Antibody detects endogenous levels of total Osteoprotegerin.
RRID:
AB_2838784
Cite Format: Affinity Biosciences Cat# DF6824, RRID:AB_2838784.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

MGC29565; OCIF; OPG; Osteoclastogenesis inhibitory factor; Osteoprotegerin; PDB5; TNF receptor superfamily member 11b; TNFRSF 11B; TNFRSF11B; TR 1; TR1; TR11B_HUMAN; Tumor necrosis factor receptor superfamily member 11B;

Immunogens

Immunogen:

A synthesized peptide derived from human Osteoprotegerin, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
O00300 TR11B_HUMAN:

Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal muscle. Highly expressed in fetal kidney, liver and lung.

Description:
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. [provided by RefSeq, Jul 2008]
Sequence:
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
80
Xenopus
70
Zebrafish
64
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts as decoy receptor for TNFSF11/RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local ratio between TNFSF11 and TNFRSF11B. May also play a role in preventing arterial calcification. May act as decoy receptor for TNFSF10/TRAIL and protect against apoptosis. TNFSF10/TRAIL binding blocks the inhibition of osteoclastogenesis.

PTMs:

N-glycosylated. Contains sialic acid residues.

The N-terminus is blocked.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal muscle. Highly expressed in fetal kidney, liver and lung.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

References

1). Force-induced Caspase-1-dependent pyroptosis regulates orthodontic tooth movement. International journal of oral science, 2024 (PubMed: 38221531) [IF=10.8]

2). Osteogenic potential evaluation of biotin combined with magnesium-doped hydroxyapatite sustained-release film. Materials science & engineering-C, Materials for biological applications, 2022 (PubMed: 35581076) [IF=8.1]

3). IGFBP7 acts as a negative regulator of RANKL-induced osteoclastogenesis and oestrogen deficiency-induced bone loss. CELL PROLIFERATION, 2020 (PubMed: 31889368) [IF=5.9]

Application: WB    Species: mouse    Sample: MC3T3-E1

Figure S1.| The results of western-blot analysis showed that different concentrations of recombinant IGFBP7 increased the protein expression of OPG in osteoblastic cell line MC3T3-E1, whereas the expression of RANKL was not affected after 3 days’ IGFBP7 treatment. OPG, osteoprotegerin; RANKL, receptor activator of nuclear factor-κB ligand.

4). DEC1 deficiency promotes osteoclastic activity by augmenting NFATc1 signaling via transactivation and the Ca2+/calcineurin pathway. Biochemical pharmacology, 2025 (PubMed: 39824467) [IF=5.3]

5). Yunvjian decoction attenuates lipopolysaccharide-induced periodontitis by suppressing NFκB/NLRP3/IL-1β pathway. Journal of ethnopharmacology, 2024 (PubMed: 37802377) [IF=4.8]

6). Exogenous iron caused osteocyte apoptosis, increased RANKL production, and stimulated bone resorption through oxidative stress in a murine model. Chemico-biological interactions, 2024 (PubMed: 38971422) [IF=4.7]

7). Preventive and Therapeutic Potential of Streptococcus cristatus CA119 in Experimental Periodontitis in Rats. Probiotics and antimicrobial proteins, 2024 (PubMed: 38607584) [IF=4.4]

8). Hexokinase 2‐mediated glycolysis promotes receptor activator of NF‐κB ligand expression in Porphyromonas gingivalis lipopolysaccharide‐treated osteoblasts. JOURNAL OF PERIODONTOLOGY, 2022 (PubMed: 34585393) [IF=4.2]

9). OPG gene-modified adipose-derived stem cells improve bone formation around implants in osteoporotic rat maxillae. Heliyon, 2023 (PubMed: 37817994) [IF=4.0]

10). Neuropeptide Y1 receptor antagonist promotes osteoporosis and microdamage repair and enhances osteogenic differentiation of bone marrow stem cells via cAMP/PKA/CREB pathway. Aging-US, 2020 (PubMed: 32381754) [IF=3.9]

Application: WB    Species: rat    Sample: bone marrow

Figure 4. |Y1R antagonist treatment promoted bone formation and inhibit bone resorption in OVX rats. (A) The Alizarin Red S (yellow arrow head) and TRAP staining (red arrow head) of bone tissues in groups. (B) Immunohistochemical analysis of bone tissue among groups for MMP9 and RUNX2 (x 400). (C, D) Western blotting results of MMP, RUNX2, Cath-K, OPG and RANKL expression in bone marrow from rat femurs. The data are expressed as the means ± SD (n = 6 in each group). ***P<0.001; ****P<0.0001 vs. SHAM, and #P<0.05; ####P<0.0001 vs. OVX by one-way ANOVA and Tukey’s post hoc test

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.