Product: NPPB Antibody
Catalog: DF6902
Description: Rabbit polyclonal antibody to NPPB
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Sheep
Mol.Wt.: 15kDa; 15kD(Calculated).
Uniprot: P16860
RRID: AB_2838861

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Sheep(86%)
Clonality:
Polyclonal
Specificity:
NPPB Antibody detects endogenous levels of total NPPB.
RRID:
AB_2838861
Cite Format: Affinity Biosciences Cat# DF6902, RRID:AB_2838861.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ANFB_HUMAN; BNP; BNP(1-32); BNP(5-29); BNP-32; Brain type natriuretic peptide; Gamma brain natriuretic peptide; Gamma-brain natriuretic peptide; Natriuretic peptide precursor B; nppb; NT proBNP;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P16860 ANFB_HUMAN:

Brain and also in atria, but at much lower levels than ANP.

Description:
B-type natriuretic peptide (BNP) is a cardiac neurohormone specifically secreted from the ventricles in response to volume expansion and pressure overload (1). The actions of BNP include natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is also found to help restore the body's salt and water balance and improve heart function (2). BNP is co-secreted along with a biologically inactive N-terminal fragment (NT-proBNP). Circulating BNP and NT-proBNP provide important information on cardiac dysfunction, hypervolemia, and risk in patients with severe impairment of kidney function (3).
Sequence:
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Sheep
86
Pig
0
Horse
0
Bovine
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P16860 As Substrate

Site PTM Type Enzyme
S36 Phosphorylation
T62 O-Glycosylation
S63 O-Glycosylation
S70 O-Glycosylation
T74 O-Glycosylation
S79 O-Glycosylation
T84 O-Glycosylation
T84 Phosphorylation
T97 O-Glycosylation
S103 Phosphorylation

Research Backgrounds

Function:

Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.

PTMs:

The brain natriuretic peptide 32 form is cleaved at Pro-104 by the prolyl endopeptidase FAP (seprase) activity (in vitro).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Brain and also in atria, but at much lower levels than ANP.

Family&Domains:

Belongs to the natriuretic peptide family.

Research Fields

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

References

1). UGCG modulates heart hypertrophy through B4GalT5-mediated mitochondrial oxidative stress and the ERK signaling pathway. Cellular & Molecular Biology Letters, 2023 (PubMed: 37658291) [IF=9.2]

Application: WB    Species: Mouse    Sample: hearts

Fig. 3 Inhibition of UGCG expression ameliorated heart hypertrophy and heart fibrosis. A–C mRNA levels of ANP, BNP, and β-MHC in hearts from different groups (N = 6). D–G Western blot results of Col1, ANP, BNP expression levels in hearts from different groups (N = 3). H, J HE staining showed the cell surface area of cardiomyocytes from different groups (N = 6). I, K Immunohistochemical images of α-SMA staining in heart fibroblasts from different groups (N = 6). L, N Western blot results of ANP and BNP expression levels in cardiomyocytes from different groups (N = 3). *p 

2). Positive feedback loop involving AMPK and CLYBL acetylation links metabolic rewiring and inflammatory responses. Cell death & disease, 2025 (PubMed: 39863605) [IF=8.1]

3). Bmi‐1‐RING1B prevents GATA4‐dependent senescence‐associated pathological cardiac hypertrophy by promoting autophagic degradation of GATA4. Clinical and Translational Medicine, 2022 (PubMed: 35390228) [IF=7.9]

Application: WB    Species: mouse    Sample: cardiac extracts

FIGURE 1 | Bmi-1-RING1B and autophagy are negatively related to SA-PCH.(E) Western blots of cardiac extracts of WT young (8-week-old) or aging (20-month-old) mice showing Bmi-1, RING1B,LC3BII, Ang II, GATA4, ANP, BNP, NF-κB-p65 and p-p65 (Ser536), IκB-α and p-IκB-α (Ser32); β-actin was the loading control.

Application: IHC    Species: mouse    Sample: myocardial tissues and cardiomyocytes

Fig. 2 |Bmi-1 deficiency aggravates cardiac hypertrophy and decreases autophagic flux.(I) Representative micrographs of paraffin-embedded heart sections immunohistochemical staining for ANP, BNP and GATA4.

4). Chronic β-adrenergic stress contributes to cardiomyopathy in rodents with collagen-induced arthritis. Acta Pharmacologica Sinica, 2023 (PubMed: 37268711) [IF=6.9]

5). 16α-OHE1 alleviates hypoxia-induced inflammation and myocardial damage via the activation of β2-Adrenergic receptor. Molecular and cellular endocrinology (PubMed: 38518841) [IF=3.8]

6). Catalpol alleviates myocardial ischemia reperfusion injury by activating the Nrf2/HO-1 signaling pathway. MICROVASCULAR RESEARCH, 2022 (PubMed: 34919942) [IF=2.9]

7). Hexarelin protects cardiac H9C2 cells from angiotensin II-induced hypertrophy via the regulation of autophagy. Die Pharmazie - An International Journal of Pharmaceutical Sciences, 2019 (PubMed: 31526442) [IF=1.5]

Application: WB    Species: rat    Sample: H9C2 cell

Fig. 2 |Hexarelin inhibits Ang-II induced hypertrophy in H9C2 cardiomyocytes. (A) Representative images of cytoskeletal proteins in H9C2 cells after the various group treatments. Scale bar=10 μm. (B) Quantification of changes in H9C2 cell surface area after the various group treatments using Image J software (n=6). (C) Representative Western blotting images and quantitative results showing the protein expression level of BNP in H9C2 cells after the various group treatments (n=3).

8). Modulation of PTEN by hexarelin attenuates coronary artery ligation-induced heartfailure in rats. Turkish Journal Of Medical Sciences, 2019 (PubMed: 31091855) [IF=1.2]

Application: WB    Species: rat    Sample: cardiac muscle

Figure 3.| (a) Representative western blots and quantitation results of BNP. (b, c) RT-qPCR analyses of BNP and β-MHC. (d, e) Representative western blots and quantitation results of Bcl-2 and Bax. All data expressed as mean ± SD (n = 6). **P < 0.05.

9). Cardioprotective Role of Myocardial Endothelial Nitric Oxide Synthase andSerum Nitric Oxide Induced by Hexarelin in Rats with Myocardial InfarctionInduced Heart Failure. Iranian Red Crescent Medical Journal, 2021 [IF=0.4]

10). A Novel Mechanism of 16α-OHE1, One of Estrogen Metabolites, Alleviating Inflammatory Infiltration in Hypoxia-Induced Myocardial Injury via β2-Adrenergic Receptor. Research Square, 2023

Application: WB    Species: Rat    Sample:

Figure 4. 16α-OHE1 inhibits myocardial remodeling in rats with hypoxia-induced myocardial injury. (A, B) Representative H&E staining and graphical presentation of the cardiomyocyte diameters. (C-F) Representative Western blotting and graphical presentations of the cardiac hypertrophy markers atrial natriuretic peptide (ANP) and brain natriuretic peptide (BNP). (G, H) Representative Masson’s trichrome staining and graphical presentation of the collagen volume fractions, which were evaluated to assess the extent of fibrosis. n = 6. *p < 0.05, **p < 0.01 vs. N; #p < 0.05, ##p < 0.01 vs. H. The data are presented as the mean ± SEM. (one-way ANOVA)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.