Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000, IHC 1:200-1:1000, IF/ICC 1:200-1:1000, FCM 1:200-1:400
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat,Monkey
Clonality:
Monoclonal [AFB1855]
Specificity:
PDK1 antibody detects endogenous levels of total PDK1.
RRID:
AB_2833879
Cite Format: Affinity Biosciences Cat# BF0312, RRID:AB_2833879.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial; HGNC:8809; Mitochondrial pyruvate dehydrogenase kinase isoenzyme 1; PDH kinase 1; Pdk1; PDK1_HUMAN; Pyruvate dehydrogenase kinase isoform 1; Pyruvate dehydrogenase kinase, isoenzyme 1;

Immunogens

Immunogen:

Purified recombinant fragment of human PDK1 expressed in E. Coli.

Uniprot:
Gene(ID):
Expression:
Q15118 PDK1_HUMAN:

Expressed predominantly in the heart. Detected at lower levels in liver, skeletal muscle and pancreas.

Description:
Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. (provided by RefSeq). Tissue specificity: Expressed predominantly in the heart.
Sequence:
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

PTMs - Q15118 As Substrate

Site PTM Type Enzyme
S25 Phosphorylation
S67 Phosphorylation
K133 Ubiquitination
Y136 Phosphorylation P11362 (FGFR1)
K230 Ubiquitination
Y243 Phosphorylation P11362 (FGFR1) , O60674 (JAK2) , P00519 (ABL1) , P36888 (FLT3)
Y244 Phosphorylation P11362 (FGFR1)
R319 Methylation
Y336 Phosphorylation
T338 Phosphorylation P00558 (PGK1)
T346 Phosphorylation
S347 Phosphorylation
Y357 Phosphorylation
S393 Phosphorylation
S396 Phosphorylation
Y403 Phosphorylation
K405 Ubiquitination

PTMs - Q15118 As Enzyme

Substrate Site Source
P05106-1 (ITGB3) T779 Uniprot
P08559 (PDHA1) S232 Uniprot
P08559 (PDHA1) S293 Uniprot
P08559 (PDHA1) S300 Uniprot
P23443-1 (RPS6KB1) T390 Uniprot
P29803 (PDHA2) S230 Uniprot
P29803 (PDHA2) S291 Uniprot
P29803 (PDHA2) S298 Uniprot
P31749-1 (AKT1) T308 Uniprot
P31749-1 (AKT1) S473 Uniprot
P31751 (AKT2) T309 Uniprot
Q15118-1 (PDK1) S25 Uniprot
Q15118-1 (PDK1) S393 Uniprot
Q15118-1 (PDK1) S396 Uniprot
Q16513 (PKN2) T816 Uniprot
Q16513-1 (PKN2) T951 Uniprot
Q9Y243-1 (AKT3) S120 Uniprot
Q9Y243 (AKT3) T305 Uniprot

Research Backgrounds

Function:

Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Plays an important role in cellular responses to hypoxia and is important for cell proliferation under hypoxia. Protects cells against apoptosis in response to hypoxia and oxidative stress.

PTMs:

Phosphorylated by constitutively activated ABL1, FGFR1, FLT3 and JAK2 (in vitro), and this may also occur in cancer cells that express constitutively activated ABL1, FGFR1, FLT3 and JAK2. Phosphorylation at Tyr-243 and Tyr-244 strongly increases kinase activity, while phosphorylation at Tyr-136 has a lesser effect.

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed predominantly in the heart. Detected at lower levels in liver, skeletal muscle and pancreas.

Subunit Structure:

Homodimer, and heterodimer with PDK2. Interacts with the pyruvate dehydrogenase complex subunit DLAT, and is part of the multimeric pyruvate dehydrogenase complex that contains multiple copies of pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (DLAT, E2) and lipoamide dehydrogenase (DLD, E3).

Family&Domains:

Belongs to the PDK/BCKDK protein kinase family.

Research Fields

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer.   (View pathway)

· Organismal Systems > Development > Axon guidance.   (View pathway)

References

1). Tianliang Hou et al. Sevoflurane preconditioning attenuates hypoxia/reoxygenation injury of H9c2 cardiomyocytes by activation of the HIF-1/PDK-1 pathway. PeerJ 2020 Dec 21;8:e10603. (PubMed: 33391885) [IF=2.7]

Application: WB    Species: Rat    Sample: H9c2 cells

Figure 5 SPC upregulate the protein expression of HIF-1a and PDK-1. (A) Western blot image of HIF-1a protein. (B) Western blot image of PDK-1 protein. (C) HIF-1a protein expression. (D) PDK-1 protein expression. Protein content was normalized to GAPDH. Data represent mean ± SD (n = 3/group). *P < 0.05 vs Con, #P < 0.05 vs H/R, &P < 0.05 vs SPC.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.