Product: CCL20 Antibody
Catalog: DF2238
Description: Rabbit polyclonal antibody to CCL20
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse
Prediction: Pig, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 11 kDa; 11kD(Calculated).
Uniprot: P78556
RRID: AB_2839469

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Horse(86%), Sheep(86%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
CCL20 Antibody detects endogenous levels of total CCL20.
RRID:
AB_2839469
Cite Format: Affinity Biosciences Cat# DF2238, RRID:AB_2839469.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta-chemokine exodus-1; C C motif chemokine ligand 20; C-C motif chemokine 20; CC chemokine LARC; Ccl20; CCL20(2-70); CCL20_HUMAN; Chemokine (C C motif) ligand 20; Chemokine CC motif ligand 20; CKb4; Exodus 1; Exodus; LARC; Liver and activation-regulated chemokine; Macrophage inflammatory protein 3 alpha; MIP 3 alpha; MIP 3A; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; Small inducible cytokine A20; Small inducible cytokine subfamily A (Cys Cys) member 20; Small-inducible cytokine A20; ST38;

Immunogens

Immunogen:

A synthesized peptide derived from human CCL20, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P78556 CCL20_HUMAN:

Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intestine and colon.

Description:
Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213.
Sequence:
MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Dog
100
Rabbit
100
Horse
86
Sheep
86
Bovine
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells (By similarity). C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells (By similarity). Possesses antibacterial activity towards E.coli ATCC 25922 and S.aureus ATCC 29213.

PTMs:

C-terminal processed forms which lack 1, 3 or 6 amino acids are produced by proteolytic cleavage after secretion from peripheral blood monocytes.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intestine and colon.

Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

References

1). Ginsenoside Rh1, a novel casein kinase II subunit alpha (CK2α) inhibitor, retards metastasis via disrupting HHEX/CCL20 signaling cascade involved in tumor cell extravasation across endothelial barrier. Pharmacological research, 2023 (PubMed: 37944834) [IF=9.1]

Application: IF/ICC    Species: human    Sample: HUVECs

Fig. 6. CCL20 in the BC cells disrupted the endothelial barrier function. (A) Representative immunofluorescence images for VE-cadherin (green) and Phalloidin (red) in HUVECs. Scale bar: 50 µm. (B) Quantification of VE-cadherin positive area in the HUVECs (n = 3). (C) The TEER value was examined in the HUVEC monolayer following the treatment of CM (n = 6). (D) The FITC-dextran leakage from the HUVEC monolayer in the transwell. The HUVEC permeability was quantified on the basis of the fluorescence of FITC-dextran (40 kD) collected in the bottom chamber (n = 6). (E-F) Western blot analysis for ZO-1, ZO-2 and VE-cadherin in the HUVEC lysates following the stimulation of recombinant human CCL20 (n = 3). (G) The mRNA expression of CCR6 was measured using Real-time PCR after the transfection of CCR6 siRNA (n = 3). (H-I) ZO-1, ZO-2 and VE-cadherin expression in the HUVECs after the transfection of siRNA (n = 3). (J) The picture of tumors harvested at the endpoint in different groups is shown. (K) The growth curves of tumors in the indicated groups were calculated in the mouse xenograft model. Tumor volumes were quantified with the formula: volume = A×B2 × 0.5 (n = 6). (L) Representative immunofluorescence images for CD31(red) to stain tumor blood vessels. Scale bar: 100 µm. (M) Endothelium and associated smooth muscle cells were detected by co-staining for CD31 (red) and α-SMA (pink). Scale bar: 100 µm. (N) Representative immunofluorescence images for lectin perfusion (green) in the tumor blood vessels in the indicated groups. Scale bar: 100 µm. (O) Representative immunofluorescence images for dextran leakage (red) in the tumor blood vessels. Scale bar: 100 µm. (P) Quantification of vascular density in (L) (n = 3). (Q) Quantification for the CD31+αSMA+ area in (M) (n = 3). (R) Quantification for the lectin positive area in (N) (n = 3). (S) Quantification for the dextran positive area in (O) (n = 3). *P 

2). Development and Validation of a 7-Gene Inflammatory Signature Forecasts Prognosis and Diverse Immune Landscape in Lung Adenocarcinoma. Frontiers in Molecular Biosciences, 2022 (PubMed: 35372503) [IF=5.0]

Application: WB    Species: human    Sample: bronchial epithelial cell line (16-HBS) and lung adenocarcinoma cell line (A549)

FIGURE 10 | Protein expression of seven model genes. (A–C) Immunohistochemical staining images of MMP14 (A), PCDH7 (B), and LAMP3 (C) from the HPA database. (D) Western blotting results shows the protein expression of BTG2, TLR2, CCL20, and IL7R in a normal bronchial epithelial cell line (16-HBS) and lung adenocarcinoma cell line (A549).

3). LR12 Promotes Liver Repair by Improving the Resolution of Inflammation and Liver Regeneration in Mice with Thioacetamide- (TAA-) Induced Acute Liver Failure. MEDIATORS OF INFLAMMATION, 2021 (PubMed: 34135689) [IF=4.4]

Application: IF/ICC    Species: Mice    Sample: liver tissues

Figure 5 LR12 promoted hepatocyte regeneration via CCL20 secreted by macrophages. (a) The cytokine protein microarray of the supernatant from macrophages. (b) ELISA of CCL20 in the supernatant from macrophages. (c) The mRNA level of CCL20 in macrophages. (d) CLSM showing F4/80 and CCL20 staining in the liver tissues. (e) Western blot analysis of PCNA in LO2 cells stimulated with CCL20. Data were presented as the mean ± standard deviation (SD). ∗P < 0.05, ∗∗P < 0.01, and ∗∗∗P < 0.001 versus control group.

4). CD40LG and GZMB were correlated with adipose tissue macrophage infiltration and involved in obstructive sleep apnea related metabolic dysregulation: Evidence from bioinformatics analysis. Frontiers in genetics, 2023 (PubMed: 36923793) [IF=3.7]

5). A Mouse Model of Damp-Heat Syndrome in Traditional Chinese Medicine and Its Impact on Pancreatic Tumor Growth. Frontiers in Oncology, 2022 (PubMed: 35957897) [IF=3.5]

Application: WB    Species: Mice    Sample: tumor tissues

Figure 6 Chemokine differences between tumor-bearing mice with and without damp-heat syndrome. (A) Heatmap indicating serum chemokine distribution between the two groups (n = 10 in the T group, n = 9 in the TD group). (B) Heatmap indicating tumor tissue chemokine distribution between the two groups (n = 3 in each group). (C) Relative mRNA expression of tissue chemokines tested by qPCR (n = 10 in the T group, n = 9 in the TD group). (D) Relative protein expression of tissue chemokines tested by western blotting (n = 8 in each group). *p < 0.05, **p < 0.01, ***p < 0.001 compared with the T group.

6). Systematic Analyses of a Chemokine Family-Based Risk Model Predicting Clinical Outcome and Immunotherapy Response in Lung Adenocarcinoma. Cell Transplantation, 2021 (PubMed: 34705571) [IF=3.2]

Application: IHC    Species: Human    Sample:

Figure 8. CCL20 was highly expressed in LUAD tissues compared to adjacent tissues and related to poor overall survival. (a) The 20 X and 200 X representative IHC staining. (b) The expression of CCL20 was significant higher in LUAD tissues compared to those in paired normal tissues (P < 0.001). (c) Kaplan-Meier plot of 52 patients with survival data (from tissue arrays) stratified by CCL20 expression levels. Patients possessing more CCL20 exhibited poorer overall survival (P = 0.011). LUAD, lung adenocarcinoma; IHC, immunohistochemical.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.