CD63 Antibody - #DF2305

(7)   (4)  
Product: CD63 Antibody
Catalog: DF2305
Description: Rabbit polyclonal antibody to CD63
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 26kD,47kD; 26kD(Calculated).
Uniprot: P08962
RRID: AB_2839529

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CD63 Antibody detects endogenous levels of total CD63.
RRID:
AB_2839529
Cite Format: Affinity Biosciences Cat# DF2305, RRID:AB_2839529.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Lysosomal associated membrane protein 3; CD 63; CD63; CD63 antigen (melanoma 1 antigen); CD63 antigen; CD63 antigen melanoma 1 antigen; CD63 molecule; CD63_HUMAN; gp55; Granulophysin; LAMP 3; LAMP-3; LAMP3; LIMP; Lysosomal-associated membrane protein 3; Lysosome associated membrane glycoprotein 3; Mast cell antigen AD1; ME491; Melanoma 1 antigen; Melanoma associated antigen ME491; Melanoma associated antigen MLA1; Melanoma-associated antigen ME491; MGC72893; MLA 1; MLA1; NGA; Ocular melanoma associated antigen; Ocular melanoma-associated antigen; OMA81H; PTLGP40; Tetraspanin 30; Tetraspanin-30; Tspan 30; Tspan-30; TSPAN30;

Immunogens

Immunogen:
Uniprot:

P08962(CD63_HUMAN) >>Visit HPA database.

Gene(ID):
CD63(967)
Expression:
P08962 CD63_HUMAN:

Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages.

Description:
This antigen is associated with early stages of melanoma tumor progression. May play a role in growth regulation
Sequence:
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

PTMs - P08962 As Substrate

Site PTM Type Enzyme
K110 Ubiquitination
K128 Ubiquitination
N130 N-Glycosylation
S159 Phosphorylation
K162 Ubiquitination
K188 Ubiquitination
K194 Ubiquitination

Research Backgrounds

Function:

Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.

PTMs:

Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro).

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Lysosome membrane>Multi-pass membrane protein. Late endosome membrane>Multi-pass membrane protein. Endosome>Multivesicular body. Melanosome. Secreted>Extracellular exosome. Cell surface.
Note: Also found in Weibel-Palade bodies of endothelial cells (PubMed:10793155). Located in platelet dense granules (PubMed:7682577). Detected in a subset of pre-melanosomes. Detected on intralumenal vesicles (ILVs) within multivesicular bodies (PubMed:21962903).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages.

Subunit Structure:

Interacts with TIMP1 and ITGB1 and recruits TIMP1 to ITGB1. Interacts with CD9. Identified in a complex with CD9 and ITGB3. Interacts with PMEL. Interacts with KDR/VEGFR2; identified in a complex with ITGB1 and KDR/VEGFR2 and is required to recruit KDR to ITGB1 complexes. Interacts with SYT7 (By similarity).

Family&Domains:

Belongs to the tetraspanin (TM4SF) family.

Research Fields

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

References

1). Extracellular vesicles delivering nuclear factor I/C for hard tissue engineering: Treatment of apical periodontitis and dentin regeneration. Journal of Tissue Engineering, 2022 (PubMed: 35321254) [IF=6.7]

Application: WB    Species: rat    Sample:

Figure 2. | Identification of EVs derived from LPS-stimulated DPCs (LPS-EVs) and establishment of in vitro model.(g) Western blot analysis of EVs surface markers (CD9, CD63, CD81 and TSG101).

Application: IHC    Species: rat    Sample: apical papilla

Figure 1. Higher expression of EV surface marker CD63 in apical papilla of rat apical periodontitis model. (b and c) Apical papilla from healthy and inflamed mandibular incisors (n=3) was examined using immunohistochemical staining. Expression of CD63 (EV surface marker), caspase-3, and tumor necrosis factor-a (TNF-a) could barely be detected within healthy apical papilla (left). Significant upregulation of CD63, caspase-3, and TNFa were observed in inflamed apical papilla (right).
2). Improving the process of spermatogenesis in azoospermic mice using spermatogonial stem cells co-cultured with epididymosomes in three-dimensional culture system. Life Sciences, 2022 (PubMed: 36220369) [IF=5.2]
3). Lovastatin attenuates sevoflurane-induced cognitive disorder in aged rats via reducing Aβ accumulation. NEUROCHEMISTRY INTERNATIONAL, 2021 (PubMed: 34048842) [IF=4.4]

Application: IF/ICC    Species: Rat    Sample: BV-2 cells

Fig. 2. Lovastatin increased IDE-enriched exosome secretion in sevoflurane-exposed BV-2 cells. (A) The mRNA level of IDE in BV-2 cells analyzed by Realtime PCR. (B) CD63 expression detected by flow cytometry. (C) IDE protein level in BV-2 cellderived exosomes. (D) Co-expression of CD63 and IDE examined using immunofluorescence staining. Scale bar: 50 μm. Data were presented as mean ± standard deviation (SD) (N = 3). Significance *P < 0.05, **P < 0.01, and ***P < 0.001. Abbreviations: Control, Con; Sevoflurane, Sevo; Lovastatin, Lova; Sevoflurane + Lovastatin, Sevo + Lova; IDE; Insulin-degrading enzyme.
4). Hypoxia promotes the expression of Von Willebrand factor in breast cancer cells by up-regulating the transcription factor YY1 and down-regulating the hsa-miR-424. European Journal of Pharmacology, 2022 (PubMed: 36202224) [IF=4.2]
5). Schwann cell‑derived exosomes induce bone marrow‑derived mesenchymal stem cells to express Schwann cell markers in vitro. Molecular Medicine Reports, 2020 (PubMed: 32016464) [IF=3.4]

Application: WB    Species: rat    Sample: fibroblasts and RSC96 cells

Figure 1. |Extraction of exosomes from fibroblasts and RSC96 cells. (A) Transmission electron microscopy images of exosomes (yellow arrows) extracted from fibroblasts or RSC96 Schwann cells (magnification, x25,000). Scale bar, 200 nm. (B) Protein expression of exosome marker proteins CD81 and CD63, and the endoplasmic reticulum marker Calnexin were assessed by western blotting.
6). The effect of epididymosomes on the development of frozen-thawed mouse spermatogonial stem cells after culture in a decellularized testicular scaffold and transplantation into azoospermic mice. Journal of assisted reproduction and genetics, 2024 (PubMed: 38839698) [IF=3.2]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.