Product: IL12B Antibody
Catalog: DF2519
Description: Rabbit polyclonal antibody to IL12B
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse
Prediction: Dog
Mol.Wt.: 46 kDa; 37kD(Calculated).
Uniprot: P29460
RRID: AB_2839725

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Dog(86%)
Clonality:
Polyclonal
Specificity:
IL12B Antibody detects endogenous levels of total IL12B.
RRID:
AB_2839725
Cite Format: Affinity Biosciences Cat# DF2519, RRID:AB_2839725.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CLMF; CLMF p40; CLMF2; Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL 12 subunit p40; IL 12B; IL-12 subunit p40; IL-12B; IL12 subunit p40; IL12B; IL12B_HUMAN; interleukin 12 beta chain; Interleukin 12 p40; Interleukin 12 subunit beta; Interleukin 12B; Interleukin-12 subunit beta; natural killer cell stimulatory factor 40 kD subunit; NK cell stimulatory factor chain 2; NKSF; NKSF2; p40;

Immunogens

Immunogen:

A synthesized peptide derived from human IL12B, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.;Associates with IL23A to form the IL-23 interleukin, an heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to an heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Sequence:
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
86
Pig
75
Rabbit
75
Horse
63
Bovine
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.

PTMs:

Known to be C-mannosylated in the recombinant protein; it is not yet known for sure if the wild-type protein is also modified.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the IL-12B family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).

· Human Diseases > Immune diseases > Allograft rejection.

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.   (View pathway)

References

1). Exercise modulates polarization of TAMs and expression of related immune checkpoints in mice with lung cancer. Journal of Cancer, 2022 (PubMed: 36186906) [IF=3.3]

Application: WB    Species: Mouse    Sample: lung cancer tissues

Figure 2. Effects of exercise on the polarization of TAMs in lung cancer tissues. A: CD86 (red) and F4/80 (green) immunofluorescence staining (scale bar, 50μm). B: CD206 (red) and F4/80 (green) immunofluorescence staining (scale bar, 50μm). C: Statistics of the percentage of CD86 positive macrophages in the lung tissues of mice in each group (n=3). D: Statistics of the percentage of CD206 positive macrophages in the lung tissues of mice in each group (n=3). E: mRNA levels of M1 macrophage-related markers (n=8). F: mRNA levels of M2 macrophage-related markers (n=8). G, H: Expression levels of IL-12 in lung cancer tissues (n=6). G, I: Expression levels of IL-10 in lung cancer tissues (n=6). J, K, L: Plasma levels of IL-12(J), IL-10(K) and IFN-γ(L) (n=8). Note: &, && respectively represent a significant difference compared with the Saline group (P

2). Wilforlide A ameliorates the progression of rheumatoid arthritis by inhibiting M1 macrophage polarization. Journal of Pharmacological Sciences, 2022 (PubMed: 34924115) [IF=3.0]

Application: WB    Species: Mouse    Sample:

Fig. 5. Effects of Wilforlide A on M1 macrophage polarization in LPS/IFN-γ-induced macrophages. (A–B) Western blot and quantitative results of p65 in the nucleus of macrophages. §

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.