Product: HTR3E Antibody
Catalog: DF2708
Description: Rabbit polyclonal antibody to HTR3E
Application: WB IHC
Cited expt.: WB
Reactivity: Human
Mol.Wt.: 51kDa; 51kD(Calculated).
Uniprot: A5X5Y0
RRID: AB_2839914

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
HTR3E Antibody detects endogenous levels of total HTR3E.
RRID:
AB_2839914
Cite Format: Affinity Biosciences Cat# DF2708, RRID:AB_2839914.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

5-HT-3; 5-HT3 receptor subunit E splice variant HTR3Ea; 5-HT3c1; 5-HT3E; 5-HT3R; 5-hydroxytryptamine (serotonin) receptor 3, family member E; 5-hydroxytryptamine receptor 3 subunit E; 5-hydroxytryptamine receptor 3E; 5HT3c1; 5HT3E; 5HT3R; HTR3; MGC120035; MGC120036; MGC120037; SEROTONIN 5-HT-3E RECEPTOR; serotonin receptor 3 subunit E; Serotonin receptor 3E;

Immunogens

Immunogen:

A synthesized peptide derived from human HTR3E, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
A5X5Y0 5HT3E_HUMAN:

Expressed in adult colon and intestine.

Sequence:
MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT

Research Backgrounds

Function:

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.
Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in adult colon and intestine.

Family&Domains:

Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3E sub-subfamily.

Research Fields

· Organismal Systems > Nervous system > Serotonergic synapse.

· Organismal Systems > Sensory system > Taste transduction.

References

1). Bilirubin Induces Pain Desensitization in Cholestasis by Activating 5-Hydroxytryptamine 3A Receptor in Spinal Cord. Frontiers in Cell and Developmental Biology, 2021 (PubMed: 33869168) [IF=4.6]

Application: WB    Species: Rat    Sample: HEK293 cells

FIGURE 2 Bilirubin increased 5-HT3A receptor expression and neuron activities in the spinal cord. (A) 5-HT3A receptor expression increased gradually in spinal cord enlargement of BDL rats, whereas expression of 5-HT3B, 5-HT3C, 5-HT3D, and 5-HT3E receptors did not change significantly. (B) The quantitative analysis of 5-HT3A receptor expression in BDL rats. (C) Intrathecal administration of bilirubin increased 5-HT3A receptor expression without changing other subtypes. (D) The quantitative analysis of 5-HT3A receptor expression after intrathecal administration of bilirubin in normal rats. (E) SDHNs cultured with bilirubin showed increased 5-HT3A receptor expression without changing other subtypes. (F) The quantitative analysis of 5-HT3A receptor expression in SDHNs. (G) Immunofluorescence showed that 5-HT3A receptor expression increased in laminas I and II in the spinal cords of BDL rats. The increased C-Fos protein (marker of neuron activity) expression indicated that neuron activities were also enhanced in the spinal cords of BDL rats. *P < 0.05.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.