Product: Phospho-MRLC1 (Thr19+Ser20) Antibody
Catalog: AF8010
Description: Rabbit polyclonal antibody to Phospho-MRLC1 (Thr19+Ser20)
Application: WB
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 18kDa(Observed); 20kD(Calculated).
Uniprot: P24844
RRID: AB_2840073

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
Phospho-MRLC1 (Thr19+Ser20) Antibody detects endogenous levels of MRLC1 only when phosphorylated at Thr19+Ser20.
RRID:
AB_2840073
Cite Format: Affinity Biosciences Cat# AF8010, RRID:AB_2840073.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

20 kDa myosin light chain;Human 20kDa myosin light chain (MLC2) mRNA complete cds;LC20;MGC3505;MLC 2;MLC-2C;MLC2;MLY 9;MRLC1;MYL9;MYL9_HUMAN;Myosin light chain 9 regulatory;Myosin light polypeptide 9 regulatory;myosin regulatory light chain 1;Myosin regulatory light chain 2;Myosin regulatory light chain 2 smooth muscle isoform;Myosin regulatory light chain 9;Myosin regulatory light chain MRLC1;Myosin regulatory light polypeptide 9;Myosin RLC;Myosin vascular smooth muscle light chain 2;MYRL2;OTTHUMP00000030857;smooth muscle isoform; ML12B_HUMAN;MLC 2A;MLC-2;MLC-2a;MLC-B;MLC20;MRLC2;MYL12B;MYLC2B;Myosin light chain 12B regulatory;Myosin regulatory light chain 12B;myosin regulatory light chain 2;Myosin regulatory light chain 2-B;myosin regulatory light chain 2-B, smooth muscle isoform;Myosin regulatory light chain 20 kDa;Myosin regulatory light chain MRLC2;myosin, light chain 12B, regulatory;OTTHUMP00000162244;OTTHUMP00000165806;OTTHUMP00000165807;OTTHUMP00000165808;SHUJUN-1;smooth muscle isoform;

Immunogens

Immunogen:

A synthesized peptide derived from human MRLC1 around the phosphorylation site of Thr19+Ser20.

Uniprot:
Gene(ID):
Expression:
P24844 MYL9_HUMAN:

Smooth muscle tissues and in some, but not all, nonmuscle cells.

Description:
Myosin is composed of six polypeptide chains: two identical heavy chains and two pairs of light chains. Myosin light chain 2 (MLC2), also known as myosin regulatory light chain (MRLC), RLC, or LC20, has many isoforms depending on its distribution. In smooth muscle, MLC2 is phosphorylated at Thr18 and Ser19 by myosin light chain kinase (MLCK) in a Ca2+/calmodulin-dependent manner (1). This phosphorylation is correlated with myosin ATPase activity and smooth muscle contraction (2). ROCK also phosphorylates Ser19 of smooth muscle MLC2, which regulates the assembly of stress fibers (3). Phosphorylation of smooth muscle MLC2 at Ser1/Ser2 and Ser9 by PKC and cdc2 has been reported to inhibit myosin ATPase activity (4,5). Phosphorylation by cdc2 controls the timing of cytokinesis (5). Transgenic mice lacking phosphorylation sites on the cardiac muscle isoform show morphological and functional abnormalities (6).
Sequence:
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.

PTMs:

Phosphorylation increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. It is required to generate the driving force in the migration of the cells but not necessary for localization of myosin-2 at the leading edge.

Tissue Specificity:

Smooth muscle tissues and in some, but not all, nonmuscle cells.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

· Organismal Systems > Endocrine system > Oxytocin signaling pathway.

References

1). Adducin-1 Facilitates Influenza Virus Endosomal Trafficking and Uncoating by Regulating Branched Actin Dynamics and Myosin IIB Activity. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2025 (PubMed: 40472230) [IF=15.1]

2). Patchouli alcohol attenuates 5-fluorouracil-induced intestinal mucositis via TLR2/MyD88/NF-kB pathway and regulation of microbiota. BIOMEDICINE & PHARMACOTHERAPY, 2020 (PubMed: 32004938) [IF=6.9]

Application: WB    Species: rat    Sample: Intestinal

Fig. 4. |Effect of PA on intestinal mocusal barrier proteins. (a–d) Relative mRNA expression of MLCK, ZO-1, occludin and claudin-1 (n = 4); (e–i) Expressions of MLC,p-MLC, ZO-1, occludin and claudin-1proteins (n = 3). Values were represented the mean ± SEM. **P < 0.01, *P < 0.05 versus 5-FU group and ##P < 0.01 versus normal group.

3). High Glucose Aggravates Retinal Endothelial Cell Dysfunction by Activating the RhoA/ROCK1/pMLC/Connexin43 Signaling Pathway. Investigative Ophthalmology & Visual Science, 2022 (PubMed: 35881407) [IF=5.0]

Application: WB    Species: Mice    Sample: mRMVECs

Figure 6.RhoA/ROCK1 signaling regulates Cx43 through the directly interaction between pMLC and Cx43. (A, C) Co-immunoprecipitation of pMLC and Cx43 in mRMVECs with or without high glucose. (B, D, E) The protein expression of pMLC, MLC, and Cx43 in mRMVECs treated with different conditions. ns, no significance. EV, empty vector. *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001 compared with the control group; ##P < 0.01 compared with the high glucose (30 mM) group. N = 3. The bars are the mean ± SD.

4). Study on the Mechanism of Sancao Tiaowei Decoction in the Treatment of MNNG-Induced Precancerous Lesions of Gastric Carcinoma Through Hedgehog Signaling Pathway. Frontiers in Oncology, 2022 (PubMed: 35646631) [IF=3.5]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.