TNFRSF13C Antibody - #DF10156
Product: | TNFRSF13C Antibody |
Catalog: | DF10156 |
Description: | Rabbit polyclonal antibody to TNFRSF13C |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 19 kDa; 19kD(Calculated). |
Uniprot: | Q96RJ3 |
RRID: | AB_2840735 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10156, RRID:AB_2840735.
Fold/Unfold
B cell activating factor receptor; B-cell-activating factor receptor; BAFF R; BAFF receptor; BAFF-R; BAFFR; BLyS receptor 3; BlySR3; BR 3; BR3; BROMIX; CD 268; CD268; CD268 antigen; CVID4; MGC138235; OTTHUMP00000028746; Prolixin; TNFRSF 13C; Tnfrsf13c; TR13C_HUMAN; Tumor necrosis factor receptor subunit member 13C; Tumor necrosis factor receptor superfamily member 13C;
Immunogens
A synthesized peptide derived from human TNFRSF13C, corresponding to a region within the internal amino acids.
Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes.
- Q96RJ3 TR13C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Research Backgrounds
B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
Membrane>Single-pass type III membrane protein.
Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Immune diseases > Primary immunodeficiency.
· Organismal Systems > Immune system > Intestinal immune network for IgA production. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.