Product: HES1 Antibody
Catalog: DF7569
Description: Rabbit polyclonal antibody to HES1
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.: 30 kDa(Observed); 30kD(Calculated).
Uniprot: Q14469
RRID: AB_2841062

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Chicken(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
HES1 Antibody detects endogenous levels of total HES1.
RRID:
AB_2841062
Cite Format: Affinity Biosciences Cat# DF7569, RRID:AB_2841062.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

bHLHb39; C-HAIRY1; c-hairy1A; Class B basic helix-loop-helix protein 39; FLJ20408; Hairy and enhancer of split 1 (Drosophila); Hairy and enhancer of split 1; Hairy homolog (Drosophila); Hairy homolog; Hairy like; Hairy, Drosophila, homolog of; Hairy-like protein; Hairy/enhancer of split, Drosophila, homolog of, 1; HAIRY1; HES-1; hes1; Hes1 hairy and enhancer of split 1 (Drosophila); HES1_HUMAN; HHL; HL; HRY; MGC129109; OTTHUMP00000209031; RHL; Transcription factor HES-1;

Immunogens

Immunogen:

A synthesized peptide derived from human HES1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Chicken
100
Rabbit
100
Xenopus
92
Dog
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG).

The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins.

The bHLH, as well as cooperation between the central Orange domain and the C-terminal WRPW motif, is required for transcriptional repressor activity.

Research Fields

· Environmental Information Processing > Signal transduction > Notch signaling pathway.   (View pathway)

· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.

· Human Diseases > Endocrine and metabolic diseases > Maturity onset diabetes of the young.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

References

1). Lactylated SPTAN1 Accelerates Hepatocellular Carcinoma Progression by Promoting NOTCH1/HES1 Activation and Immunosuppression. Advanced Science, 2025 [IF=14.1]

2). Kindlin-3 Promotes Angiogenesis via Notch Signalling and Is Crucial for Functional Recovery Postmyocardial Infarction. Journal of cellular and molecular medicine, 2025 (PubMed: 40099947) [IF=5.3]

Application: WB    Species: Mouse    Sample: CMECs

FIGURE 5. Kindlin‐3 overexpression activates the Notch signalling pathway. (A) Representative immunohistochemical staining of Notch1 in AAV‐NC and AAV‐K3 mice post‐MI or Sham operation, including the remote area (RA) and border area (BA). (Scale bars = 20 μm). Notch1 expression levels were quantified and compared (n = 6). (B) qPCR analysis of Notch1 mRNA expression in AAV‐NC and AAV‐K3 mice post‐MI or Sham operation, including the remote area (RA) and border area (BA) (n = 4). (C) Representative Western blot images and quantitative analysis showing Notch1, Hes1, and Hif‐1α protein levels in CMECs. ns, not significant. Data were presented as mean ± SEM. **p 

3). TMT-based quantitative proteomics analysis reveals the role of Notch signaling in FAdV-4-infected LMH cell. Frontiers in Microbiology, 2022 (PubMed: 36187945) [IF=5.2]

4). Notch1 contributes to TNF-α-induced proliferation and migration of airway smooth muscle cells through regulation of the Hes1/PTEN axis. International Immunopharmacology, 2020 (PubMed: 32871474) [IF=4.8]

Application: WB    Species: mouse    Sample: ASM cells

Fig. 5.| Notch1 knockdown decreased Hes1 and increased PTEN expression in TNF-α-induced ASM cells. ASM cells were transfected with NC or Notch1 siRNA for 48 h and then stimulated with TNF-α for 24 h. (D, E) Protein expression of Hes1 was examined by western blot.

5). Xue-Jie-San prevents the early development of colitis-associated intestinal fibrosis by blocking Notch1 and FGL1 signaling pathways. Journal of ethnopharmacology, 2023 (PubMed: 37263315) [IF=4.8]

6). Neural stem cell-derived exosomes regulate neural stem cell differentiation through miR-9-Hes1 axis. Frontiers in Cell and Developmental Biology, 2021 (PubMed: 34055767) [IF=4.6]

Application: WB    Species: mouse    Sample: NSCs

FIGURE 7 | Hes1 expression is negatively regulated by miR-9 in NSCs.(C) Representative western blotting results showing the expression of Hes1 and β-actin proteins in either agomiR-C- or agomiR-9-transfected NSCs.

7). Minocycline Attenuates Sevoflurane-Induced Postoperative Cognitive Dysfunction in Aged Mice by Suppressing Hippocampal Apoptosis and the Notch Signaling Pathway-Mediated Neuroinflammation. Brain Sciences, 2023 (PubMed: 36979321) [IF=3.3]

Application: WB    Species: Mouse    Sample: hippocampal tissue

Figure 6 Minocycline alleviates sevoflurane-induced neuroinflammation via Notch signaling suppression: (A) Cell immunofluorescence was performed to assess Notch signaling-associated proteins in BV2 cells of each group. Scale bar, 20 μm; (B–G) Immunoblot detection of Notch1, cleaved Notch1, and Hes1 in BV2 cells and hippocampal tissue specimens. β-actin was utilized for normalizing data quantitated by densitometry with ImageJ. Data are mean ± SEM.

8). The regulatory roles of VEGF-Notch signaling pathway on aplastic anemia with kidney deficiency and blood stasis. JOURNAL OF CELLULAR BIOCHEMISTRY, 2019 (PubMed: 30230583) [IF=3.0]

Application: WB    Species: human    Sample: HUVECs

FIGURE 5| The expression of VEGF‐Notch signaling pathway related proteins (VEGF, VEGFR, Notch‐1, Jagged1, Delta‐like1, and hes1)in HUVECs cocultured with VEGF/Notch shRNA transfected BMSCs (n = 3). *P < 0.05 vs HUVECs (normal control); #P < 0.05 vs BMSC + NC shRNA + HUVEC. BMSC, bone marrow mesenchymal stem cell; HUVEC, human umbilical vein endothelial cell; NC, normal control; shRNA, short hairpin RNA; VEGF, vascular endothelial growth factor; VEGFR, VEGF receptor

9). Study on the mechanism of DLK1 in placenta of intrahepatic cholestasis of pregnancy. Tissue & cell, 2026 (PubMed: 41610642) [IF=2.7]

10). Sinomenine hydrochloride improves DSS-induced colitis in mice through inhibition of the Notch signaling pathway. BMC gastroenterology, 2024 (PubMed: 39695403) [IF=2.4]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.