Product: UCP1 Antibody
Catalog: DF7720
Description: Rabbit polyclonal antibody to UCP1
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 34 kDa; 33kD(Calculated).
Uniprot: P25874
RRID: AB_2841189

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(91%), Horse(91%), Sheep(91%), Rabbit(91%), Dog(91%)
Clonality:
Polyclonal
Specificity:
UCP1 Antibody detects endogenous levels of total UCP1.
RRID:
AB_2841189
Cite Format: Affinity Biosciences Cat# DF7720, RRID:AB_2841189.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

mitochondrial brown fat uncoupling protein; Mitochondrial brown fat uncoupling protein 1; SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP 1; UCP; UCP1; UCP1_HUMAN; uncoupling protein 1 (mitochondrial, proton carrier); Uncoupling protein 1;

Immunogens

Immunogen:

A synthesized peptide derived from human UCP1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P25874 UCP1_HUMAN:

Brown adipose tissue.

Sequence:
MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
91
Bovine
91
Sheep
91
Dog
91
Rabbit
91
Xenopus
70
Pig
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates to non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance (By similarity). Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria (By similarity).

PTMs:

May undergo sulfenylation upon cold exposure. May increase the sensitivity of UCP1 thermogenic function to the activation by noradrenaline probably through structural effects.

May undergo ubiquitin-mediated proteasomal degradation.

Subcellular Location:

Mitochondrion inner membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Brown adipose tissue.

Family&Domains:

Belongs to the mitochondrial carrier (TC 2.A.29) family.

Research Fields

· Environmental Information Processing > Signal transduction > Apelin signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

References

1). Atomically precise gold nanoclusters as ROS-scavenging clusterzymes to treat high-fat diet-induced obesity. Chemical Engineering Journal, 2024 [IF=13.3]

2). Pancreastatin mediated regulation of UCP-1 and energy expenditure in high fructose fed perimenopausal rats. Life Sciences, 2021 (PubMed: 34081990) [IF=5.2]

Application: WB    Species: Rat    Sample:

Fig. 4. Potential evidence of UCP-1 enhancement by PST in BAT and WAT of perimenopausal rats. RT-PCR analysis in (A) white and (B) brown adipose representing increased expression of UCP-1. In addition we performed immunoblotting of UCP-1 in (C) WAT and (D) BAT (n = 3). Expression analysis and immunohistochemical staining displayed increased UCP-1 in (E–F) WAT and (G–H) BAT of high fructose fed perimenopausal rats (n = 3). Results are means ± S.E.M. Significance values are #, *p < 0.05; ##, **p < 0.01; ###, ***p < 0.001. Comparative analysis among groups performed as #, Control vs HFrD-VCD and *

3). Ndufa8 promotes white fat Browning by improving mitochondrial respiratory chain complex I function to ameliorate obesity by in vitro and in vivo. Cellular signalling, 2024 (PubMed: 39127135) [IF=4.4]

4). Co-activating the AMPK signaling axis by low molecular weight fucoidan LF2 and fucoxanthin improves the HFD-induced metabolic syndrome in mice. Journal of Functional Foods, 2022 [IF=3.8]

5). Liraglutide promotes UCP1 expression and lipolysis of adipocytes by promoting the secretion of irisin from skeletal muscle cells. Molecular and cellular endocrinology, 2024 (PubMed: 38570133) [IF=3.8]

6). The mechanisms underlying olanzapine-induced insulin resistance via the brown adipose tissue and the therapy in rats. Adipocyte, 2022 (PubMed: 35067163) [IF=3.5]

Application: WB    Species: Rat    Sample:

Figure 6. The effect of olanzapine and Gegen Qinlian Decoction on the expression of UCP1 in iBAT and scWAT in rat models after 8 weeks gavage. (a) UCP1 expression in scWAT. (b) Representative western blots of UCP1 expression in scWAT. (c) UCP1 expression in iBAT. (d) Representative western blots of UCP1 expression in iBAT. The corresponding control levels are arbitrarily assigned at a value of 1. The values are expressed as mean±SD (n = 6). For statistical significance, *p<0.05 shows a comparison to the BL group; #p<0.05 shows a comparison to the OLZ group.

7). Green tea aqueous extract (GTAE) prevents high-fat diet-induced obesity by activating fat browning. Food Science & Nutrition, 2021 (PubMed: 34925784) [IF=3.5]

8). Lactobacillus coryniformis subsp. torquens T3 alleviates non-alcoholic fatty liver disease via reconstruction of the gut microbiota and redox system. Journal of the Science of Food and Agriculture, 2023 (PubMed: 37300818) [IF=3.3]

9). Prdm16-Mediated Browning is Involved in Resistance to Diet-Induced and Monosodium Glutamate-Induced Obesity. Diabetes Metabolic Syndrome and Obesity-Target & Therapy, 2021 (PubMed: 34737591) [IF=2.8]

Application: WB    Species: Mice    Sample: adipose tissue

Figure 5 Prdm16 and Ucp-1 expression in subcutaneous WAT and comparison of serum leptin levels in each group. (A and B) H&E staining in the inguinal subcutaneous WAT of mice induced by DIO and MSG (scale bar = 110 μm). (C and D) Prdm16 expression in the adipose tissue of mice induced by DIO and MSG according to Western blot. (E and F) Ucp-1 expression in the adipose tissue of mice induced by DIO and MSG according to Western blot. (G) Immunoreactivity of Prdm16 in the adipose tissue of mice induced by a high-fat diet and presented as the mean ± SD (n = 3). #P < 0.05 vs the DIO group. (H) Immunoreactivity of Prdm16 in the adipose tissue of mice induced by MSG and presented as the mean ± SD (n = 3). #P < 0.05 vs the MSG group. (I) Immunoreactivity of Ucp-1 in the adipose tissue of mice induced by a high-fat diet and presented as the mean ± SD (n = 3). **P < 0.01 vs the NC group. ##P < 0.01 vs the DIO group. (J) Immunoreactivity of Ucp-1 in the adipose tissue of mice induced by MSG and presented as the mean ± SD (n = 3). **P < 0.01 vs the NC group. ###P < 0.001 vs the MSG group. Abbreviations: DIO, diet-induced obesity; MSG, mice with MSG-induced obesity; NC, normal control; Prdm16, PR domain containing 16; Ucp-1, uncoupling protein-1.

10). Oct-B: A derivative of L-BAIBA significantly alleviating high-fat diet-induced obesity in mice. Biochemical and biophysical research communications, 2024 (PubMed: 39357338) [IF=2.5]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.