RPA30 Antibody - #DF8602
Product: | RPA30 Antibody |
Catalog: | DF8602 |
Description: | Rabbit polyclonal antibody to RPA30 |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 28 kDa; 29kD(Calculated). |
Uniprot: | Q13156 |
RRID: | AB_2841806 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8602, RRID:AB_2841806.
Fold/Unfold
HSU24186; MGC120333; MGC120334; p30; Replication factor A protein 4; Replication protein A 30 kDa subunit; RF A; RF-A protein 4; RFA; RFA4_HUMAN; RP A; RP-A p30; RPA; RPA4;
Immunogens
A synthesized peptide derived from human RPA30, corresponding to a region within the internal amino acids.
Preferentially expressed in placental and colon mucosa. Widely expressed at intermediate or lower levels.
- Q13156 RFA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
Research Backgrounds
As part of the alternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. Compared to the RPA2-containing, canonical RPA complex, may not support chromosomal DNA replication and cell cycle progression through S-phase. The aRPA may not promote efficient priming by DNA polymerase alpha but could support DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
Nucleus.
Note: Localizes to DNA repair foci after DNA damage.
Preferentially expressed in placental and colon mucosa. Widely expressed at intermediate or lower levels.
Belongs to the replication factor A protein 2 family.
Research Fields
· Genetic Information Processing > Replication and repair > DNA replication.
· Genetic Information Processing > Replication and repair > Nucleotide excision repair.
· Genetic Information Processing > Replication and repair > Mismatch repair.
· Genetic Information Processing > Replication and repair > Homologous recombination.
· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.