Product: RPA30 Antibody
Catalog: DF8602
Description: Rabbit polyclonal antibody to RPA30
Application: WB IF/ICC
Reactivity: Human
Mol.Wt.: 28 kDa; 29kD(Calculated).
Uniprot: Q13156
RRID: AB_2841806

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
RPA30 Antibody detects endogenous levels of total RPA30.
RRID:
AB_2841806
Cite Format: Affinity Biosciences Cat# DF8602, RRID:AB_2841806.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

HSU24186; MGC120333; MGC120334; p30; Replication factor A protein 4; Replication protein A 30 kDa subunit; RF A; RF-A protein 4; RFA; RFA4_HUMAN; RP A; RP-A p30; RPA; RPA4;

Immunogens

Immunogen:

A synthesized peptide derived from human RPA30, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q13156 RFA4_HUMAN:

Preferentially expressed in placental and colon mucosa. Widely expressed at intermediate or lower levels.

Sequence:
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

Research Backgrounds

Function:

As part of the alternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. Compared to the RPA2-containing, canonical RPA complex, may not support chromosomal DNA replication and cell cycle progression through S-phase. The aRPA may not promote efficient priming by DNA polymerase alpha but could support DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.

Subcellular Location:

Nucleus.
Note: Localizes to DNA repair foci after DNA damage.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Preferentially expressed in placental and colon mucosa. Widely expressed at intermediate or lower levels.

Family&Domains:

Belongs to the replication factor A protein 2 family.

Research Fields

· Genetic Information Processing > Replication and repair > DNA replication.

· Genetic Information Processing > Replication and repair > Nucleotide excision repair.

· Genetic Information Processing > Replication and repair > Mismatch repair.

· Genetic Information Processing > Replication and repair > Homologous recombination.

· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.