ATP5L Antibody - #DF9241
| Product: | ATP5L Antibody |
| Catalog: | DF9241 |
| Description: | Rabbit polyclonal antibody to ATP5L |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Zebrafish, Bovine |
| Mol.Wt.: | 11kDa(Observed); 11kD(Calculated). |
| Uniprot: | O75964 |
| RRID: | AB_2842437 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9241, RRID:AB_2842437.
Fold/Unfold
ATP synthase subunit g; ATP synthase, H+ transporting, mitochondrial F1F0, subunit g; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G; ATP5L; ATP5L_HUMAN; ATPase subunit g; F1Fo ATP synthase complex Fo membrane domain g subunit; mitochondrial;
Immunogens
A synthesized peptide derived from human ATP5L, corresponding to a region within C-terminal amino acids.
- O75964 ATP5L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.
Mitochondrion. Mitochondrion inner membrane.
Belongs to the ATPase g subunit family.
Research Fields
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.