Product: HES1 Antibody
Catalog: AF7575
Description: Rabbit polyclonal antibody to HES1
Application: WB
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.: 30kDa; 30kD(Calculated).
Uniprot: Q14469
RRID: AB_2843939

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
HES1 Antibody detects endogenous levels of total HES1.
RRID:
AB_2843939
Cite Format: Affinity Biosciences Cat# AF7575, RRID:AB_2843939.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

bHLHb39; C-HAIRY1; c-hairy1A; Class B basic helix-loop-helix protein 39; FLJ20408; Hairy and enhancer of split 1 (Drosophila); Hairy and enhancer of split 1; Hairy homolog (Drosophila); Hairy homolog; Hairy like; Hairy, Drosophila, homolog of; Hairy-like protein; Hairy/enhancer of split, Drosophila, homolog of, 1; HAIRY1; HES-1; hes1; Hes1 hairy and enhancer of split 1 (Drosophila); HES1_HUMAN; HHL; HL; HRY; MGC129109; OTTHUMP00000209031; RHL; Transcription factor HES-1;

Immunogens

Immunogen:

A synthesized peptide derived from human HES1, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Sequence:
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Xenopus
100
Chicken
100
Rabbit
100
Dog
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG).

The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins.

The bHLH, as well as cooperation between the central Orange domain and the C-terminal WRPW motif, is required for transcriptional repressor activity.

Research Fields

· Environmental Information Processing > Signal transduction > Notch signaling pathway.   (View pathway)

· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.

· Human Diseases > Endocrine and metabolic diseases > Maturity onset diabetes of the young.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

References

1). ALYREF promotes the metastasis of nasopharyngeal carcinoma by increasing the stability of NOTCH1 mRNA. Cell death & disease, 2024 (PubMed: 39117671) [IF=8.1]

Application: WB    Species: Human    Sample: SUNE1 cells

Fig. 3. ALYREF promotes NPC metastasis by activating NOTCH1. A GSEA results of SUNE1 and SUNE2 cells with ALYREF knockdown (siALYREF) or siRNA control (siNC). B The relative Flag-RIP enrichment ratio of NOTCH1 mRNA in HONE1 cells with ALYREF overexpression or vector control. ACTB was used as the negative control. Fold enrichment was determined by calculating the 2-ΔCt of each RIP sample relative to the corresponding input sample. The mRNA and protein levels of NOTCH1 in NPC cells with ALYREF overexpression (C) and ALYREF knockdown (D) were determined using qRT-PCR and western blotting, respectively. E The mRNA and protein levels of downstream targets (HES1, HEY1) of the Notch signaling pathway in SUNE1 cells with ALYREF knockdown or the siNC control were determined by qRT-PCR and western blotting, respectively. F Representative immunohistochemical images of lung tissues isolated from mice injected with vector control HONE1 cells (left) or ALYREF-overexpressing cells (right) via the tail vein, confirming the high expression of NOTCH1 in the ALYREF overexpression group. G The protein levels of NOTCH1 in lung metastatic nodules with ALYREF overexpression or vector control in nude mice (n = 5 per group) were determined by western blot analysis. H Inhibition of the NOTCH1 pathway abrogated the ALYREF-mediated upregulation of NPC cell invasion and metastasis. HONE1-overexpressing and corresponding vector control cells were treated with 50 mg/L LY3039478 for 24 h. Scale bar: 100 μm. *P 

2). γ‐secretase inhibitors suppress IL‐20‐mediated osteoclastogenesis via Notch signaling and are affected by Notch2 in vitro. SCANDINAVIAN JOURNAL OF IMMUNOLOGY, 2022 (PubMed: 35384009) [IF=4.1]

Application: WB    Species: Human    Sample:

FIGURE 2 20 ng/mL IL-20 treated the pre-osteoclasts for 48 h meanwhile control groups were treated with 0 ng/mL IL-20. Detected mRNA and analysed by GO Analysis and Pathway Analysis. (A) Bubble chart analysis based on KEGG databases. (B) Gene Set Enrichment Analysis of osteoclast differentiation with control groups and IL-20 treat groups. (C) Gene heatmap showed four classical gene were enriched to Notch signal pathway (Red – up regulated and green – down regulated). (D-E) The expression of Notch1 and Notch2 mRNA with different concentration of IL-20 stimulation. Analysed by one-way ANOVA with Tukey's post hoc analysis with three independent experiments. *P < .05 vs the control group; ns, not significant. (F) mRNA expression of Notch1, Notch2, Hes1 and Hey1 at 20 ng/mL IL-20 stimulation using by qRT-PCR and analysed by Student's t test. Bars represent mean ± SEM from three independent experiments. *P < .05 vs the control group; ns, not significant. (G-H) Western blotting data and analysis of Notch signal pathway. Student's t test was used to detect difference. Bars represent mean ± SEM from three independent experiments. *P < .05 vs the control group; ns, not significant

3). Notch1/Hes1‑PTEN/AKT/IL‑17A feedback loop regulates Th17 cell differentiation in mouse psoriasis‑like skin inflammation. Molecular Medicine Reports, 2022 (PubMed: 35582997) [IF=3.4]

Application: WB    Species: mouse    Sample:

Figure 9. - Protein levels of (A) hairy and enhancer of split 1, (B) PTEN, (C-1) p-AKT (Thr308), (C-2) AKT, (C-3) p-AKT (Ser473), (D-1) mTORC1, (D-2) p-mTOR (Ser2448), (E) IL-17A in mouse splenic mononuclear cells of control group, 0 µM LY294002 group, 10 µM LY294002 group and 50 µM LY294002 group. **P

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.