PAK3 Antibody - #AF7659
| Product: | PAK3 Antibody |
| Catalog: | AF7659 |
| Description: | Rabbit polyclonal antibody to PAK3 |
| Application: | WB |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 72kDa; 62kD(Calculated). |
| Uniprot: | O75914 |
| RRID: | AB_2844023 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7659, RRID:AB_2844023.
Fold/Unfold
Alpha PAK; Beta PAK; bPAK; CDKN1A; Gamma PAK; hPAK3; MRX30; MRX47; Oligophrenin 3; OPHN3; P21 (CDKN1A) activated kinase 2; P21 (CDKN1A) activated kinase 3; p21 activated kinase 1; p21 activated kinase 2; p21 activated kinase 3; P21 protein (Cdc42/Rac) activated kinase 1; P21 protein (Cdc42/Rac) activated kinase 2; P21 protein (Cdc42/Rac) activated kinase 3; P21/Cdc42/Rac1 activated kinase 1 (STE20 homolog, yeast); P21/Cdc42/Rac1 activated kinase 1 (yeast Ste20 related); P58; P65 PAK; PAK 2; PAK 3; PAK1; PAK2; PAK3; PAK3beta; PAK65; PAKalpha; PAKgamma; S6/H4 kinase; Serine/threonine protein kinase PAK 1; Serine/threonine protein kinase PAK 2; Serine/threonine protein kinase PAK 3; Serine/threonine protein kinase PAK1; Serine/threonine protein kinase PAK2; Serine/threonine protein kinase PAK3; STE20 homolog, yeast;
Immunogens
A synthesized peptide derived from human PAK3, corresponding to a region within the internal amino acids.
Restricted to the nervous system. Highly expressed in postmitotic neurons of the developing and postnatal cerebral cortex and hippocampus.
- O75914 PAK3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, or cell cycle regulation. Plays a role in dendrite spine morphogenesis as well as synapse formation and plasticity. Acts as downstream effector of the small GTPases CDC42 and RAC1. Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration. Additionally, phosphorylates TNNI3/troponin I to modulate calcium sensitivity and relaxation kinetics of thin myofilaments. May also be involved in early neuronal development.
Autophosphorylated when activated by CDC42/p21.
Neddylated.
Cytoplasm.
Restricted to the nervous system. Highly expressed in postmitotic neurons of the developing and postnatal cerebral cortex and hippocampus.
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
· Environmental Information Processing > Signal transduction > ErbB signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma. (View pathway)
· Organismal Systems > Development > Axon guidance. (View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
References
Application: WB Species: Human Sample: HepG2.2.15 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.