Product: CDKN2A/p16INK4a Antibody
Catalog: AF0228
Description: Rabbit polyclonal antibody to CDKN2A/p16INK4a
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Rabbit
Mol.Wt.: 16kDa; 17kD(Calculated).
Uniprot: P42771
RRID: AB_2833403

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Bovine(100%), Rabbit(100%)
Clonality:
Polyclonal
Specificity:
CDKN2A/p16INK4a Antibody detects endogenous levels of total CDKN2A/p16INK4a.
RRID:
AB_2833403
Cite Format: Affinity Biosciences Cat# AF0228, RRID:AB_2833403.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cyclin-dependent kinase inhibitor 2A;Cyclin-dependent kinase 4 inhibitor A;CDK4I;Multiple tumor suppressor 1;MTS-1;p16-INK4a;p16-INK4;p16INK4A;CDKN2A;CDKN2;MTS1;

Immunogens

Immunogen:

A synthesized peptide derived from human CDKN2A/p16INK4a, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P42771 CDN2A_HUMAN:

Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.

Description:
p16-INK4A a cell-cycle regulatory protein that Interacts with CDK4 and CDK6, inhibiting their ability to interact with cyclins D. Inhibits the phosphorylation of the retinoblastoma protein by CDK4 or CDK6. Four alternatively spliced isoforms have been reported.
Sequence:
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Rabbit
100
Horse
0
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.

PTMs:

Phosphorylation seems to increase interaction with CDK4.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.

Family&Domains:

Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

References

1). Heme oxygenase-1 prevents heart against myocardial infarction by attenuating ischemic injury-induced cardiomyocytes senescence. EBioMedicine, 2019 (PubMed: 30527623) [IF=9.7]

Application: IHC    Species: mouse    Sample: heart

Fig. 3. Up-regulation of HO-1 attenuated heart aging in vivo. The systemic HO-1 transgenic overexpression aged mice were 16 months. (a) The protein levels of LaminB, p53 and p16 were analyzed by western blot. n = 3. **P b .05. Data are mean ± SEM; one-way ANOVA was used for the statistical analysis. (b) Immunofluorescence staining using anti-p16 and anti-α-actinin antibodies showed the level change of p16. The tissue section thickness is 6 μm. Scale bars represent 100 μm. (c) Immunohistochemistry staining using anti-p16 antibody showed the level change of p16. The tissue section thickness is 6 μm. Scale bars represent 100 μm. (d) Relative levels of SASP containing IL-1, IL-3 and TNF-α were analyzed by qRT-PCR. n = 3 to 4. *P b .01. Data are mean ± SEM; Two-tailed t-test was used for the statistical analysis.

2). Epigallocatechin gallate suppresses mitotic clonal expansion and adipogenic differentiation of preadipocytes through impeding JAK2/STAT3-mediated transcriptional cascades. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 38552377) [IF=6.7]

3). RETRACTED: lncRNA ILF3-AS1 promotes proliferation and metastasis of colorectal cancer cells by recruiting histone methylase EZH2. Molecular Therapy - Nucleic Acids, 2021 (PubMed: 34141456) [IF=6.5]

Application: WB    Species: Mouse    Sample:

FIGURE 2 PTS reduces reduction of NLRP3 inflammasome and apoptosis in DOX-treated mice. (A) WT C57/BL6J mice were pretreated with PTS (10 mg/kg) and afterwards with DOX (20 mg/kg cumulative dose) for 6 days. Immunochemistry staining of the liver sections with anti-NLRP3 (left, scale bar = 50 μm), the quantification of NLRP3 positive area in each group (right, n = 6); (B) qPCR analyses of NLRP3, IL-1β and IL-18 mRNA levels in each group (n = 6); (C) Western blot analyses of NLRP3, ASC, Caspase-1 p20, IL-1β, and IL-18 proteins and the quantification of the blots in each group (n = 4 per group); (D) Western blot analyses of Cleaved Caspase-3, BAX, and BCL-2 proteins (left) and quantification of the blots in each group (right, n = 4 per group).

4). Mechanical stretching can modify the papillary dermis pattern and papillary fibroblast characteristics during skin regeneration. Journal of Investigative Dermatology, 2022 (PubMed: 35181299) [IF=5.7]

Application: WB    Species: Rat    Sample:

Figure 3. Poorly regenerated rat skin shows a decrease in the Fp number and characteristics of aging. (a‒f) Immunofluorescence analysis of (a) LRIG1+ Fps and (d) DLK1+ Frs in the regenerated rat dermis in each group. Quantification of (b) LRIG1+ and (e) DLK1+ cells in the dermis and (c, f) the corresponding mRNA expression; the latter was determined by qPCR and normalized to the expression level in the control group. n = 6. (g) Representative SA-β-gal staining in each group. (h) Representative WB images showing the levels of aging-related proteins such as p16, p21, PPARγ, and TGFβ1 in each group. (i‒l) Bar graph showing mRNA expression of the indicated genes, as determined by qPCR. Expression levels were normalized to the gene expression levels in the control group. n = 6. Bar = 100 μm. Data are presented as the mean ± SEM. One-way ANOVA followed by Tukey’s multiple comparison test was used. ∗P < 0.05, ∗∗P < 0.01. The results are representative of at least three independent experiments. CON denotes normal skin (control group), WELL denotes well-regenerated skin, POOR denotes poorly regenerated skin, and OLD denotes aged skin. Fp, papillary fibroblast; Fr, reticular fibroblast; n.s., nonsignificant; PPARγ, peroxisome proliferator–activated receptor-γ; SA-β-gal, senescence-associated-β-galactosidase; WB, western blot.

5). Cdc42 improve SARS-CoV-2 spike protein-induced cellular senescence through activating of Wnt/β-Catenin signaling pathway. Frontiers in cellular and infection microbiology, 2024 (PubMed: 39559701) [IF=5.7]

6). The role of miR-217/SIRT1 Axis in modulating the NLRP3 Inflammasome in the naturally aging thoracic aorta and in endothelial cells undergoing senescence induced by H2O2. International immunopharmacology, 2025 (PubMed: 41027061) [IF=4.8]

7). Specnuezhenide Alleviates Senile Osteoporosis by Activating TGR5/FXR Signaling in Bone Marrow Mesenchymal Stem Cells and RANKL-Induced Osteoclasts. Drug design, development and therapy, 2025 (PubMed: 40066080) [IF=4.7]

Application: IHC    Species: Mouse    Sample:

Figure 4 SPN attenuated senescence in D-gal-induced mice. (A) Immunohistochemistry of P16, P21, P53 and (B) related statistical analysis (n=5). Data are expressed as the mean ± SD. **P < 0.01 compared with the MOD group.

8). Plastrum testudinis Ameliorates Oxidative Stress in Nucleus Pulposus Cells via Downregulating the TNF-α Signaling Pathway. Pharmaceuticals (Basel, Switzerland), 2023 (PubMed: 37895953) [IF=4.6]

Application: WB    Species: Mouse    Sample: NPCs

Figure 5 Detection of p16, IL6, TNF-α, and ROS levels in NPCs. (A) Expression of p16 and IL-6 proteins in NPCs treated with TBHP, with or without PT. (B,C) Expression of p16 and IL-6 proteins relative to β-actin in NPCs treated with TBHP, with or without PT. (D) ROS production in NPCs treated with TBHP, with or without PT. (E) Expression of TNF-α protein in NPCs treated with LPS, with or without PT. (F) Expression of TNF-α protein relative to β-actin in NPCs treated with LPS, with or without PT. Data are the mean ± standard deviation. # p < 0.05, ## p < 0.01 vs. CTL group; * p < 0.05, ** p < 0.01 vs. 100 μM TBHP or 1 μg/mL LPS group.

9). P53 negatively regulates the osteogenic differentiation in jaw bone marrow MSCs derived from diabetic osteoporosis. Heliyon, 2023 (PubMed: 37096002) [IF=4.0]

Application: WB    Species: Human    Sample: hJBMMSCs

Fig. 6. Senescence characteristics of NC and DOP hJBMMSCs. A. The SA-β-Gal (senescence-associated β-galactosidase) expression in DOP group was significantly higher than that in NC group (Mean ± SD, n = 6). B. The mitochondrial green fluorescence in DOP group was significantly stronger than that in NC group, and the ratio of red/green fluorescence was significantly lower than that of NC group (Mean ± SD, n = 6). C. In the detection of reactive oxygen species, the fluorescence intensity of DOP group was significantly stronger than that of NC group (Mean ± SD, n = 6). D. The expression of senescence related secretory phenotype genes was increased in DOP group (Mean ± SD, n = 3). E. The expression of senescence related proteins in DOP group was increased (Mean ± SD, n = 3). *P < 0.05, **P < 0.01, ***P < 0.001.

10). Myristic acid alleviates hippocampal aging correlated with GABAergic signaling. Frontiers in Nutrition, 2022 (PubMed: 36159502) [IF=4.0]

Application: IHC    Species: Mouse    Sample: hippocampus

Figure 2 Evaluation of hippocampal histomorphology in aging mice. (A) H&E and Nissl staining in the hippocampus between 3M and 22M group. The magnifications and scale bars were shown in (A). (B,C) Nissl positive cells and Neurodegeneration rate in the hippocampus were assessed by Nissl staining. Data were represented as mean ± SD and were analyzed by Student t-test. ***P < 0.001. Arrows showed degenerated neurons. (D) IHC of senescence markers P16 and P21 in the hippocampus. The magnifications and scale bars were shown in (D). (E,F) Relative expressions of senescence markers P16 and P21 were calculated by IHC. Data were represented as mean ± SD and were analyzed by Student t-test.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.