Product: G6PC Antibody
Catalog: DF12610
Description: Rabbit polyclonal antibody to G6PC
Application: WB
Cited expt.: WB
Reactivity: Human, Mouse
Prediction: Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 40 kDa(Observed); 40kD(Calculated).
Uniprot: P35575
RRID: AB_2845572

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Prediction:
Bovine(100%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
G6PC Antibody detects endogenous levels of total G6PC.
RRID:
AB_2845572
Cite Format: Affinity Biosciences Cat# DF12610, RRID:AB_2845572.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AW107337; G-6-Pase; G6Pase; G6Pase-alpha; g6pc; G6PC_HUMAN; G6PT; Glucose-6-phosphatase alpha; Glucose-6-phosphatase; glucose-6-phosphatase, catalytic subunit; GSD1; GSD1a; MGC163350; MGC93613; RP23-281C18.19;

Immunogens

Immunogen:

A synthesized peptide derived from human G6PC, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Sheep
100
Rabbit
100
Horse
89
Dog
89
Chicken
86
Pig
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.

Subcellular Location:

Endoplasmic reticulum membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the glucose-6-phosphatase family.

Research Fields

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > AMPK signaling pathway.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.

· Metabolism > Carbohydrate metabolism > Glycolysis / Gluconeogenesis.

· Metabolism > Carbohydrate metabolism > Galactose metabolism.

· Metabolism > Carbohydrate metabolism > Starch and sucrose metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Endocrine system > Insulin signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Adipocytokine signaling pathway.

· Organismal Systems > Endocrine system > Glucagon signaling pathway.

· Organismal Systems > Digestive system > Carbohydrate digestion and absorption.

References

1). Celastrol targets the ChREBP-TXNIP axis to ameliorates type 2 diabetes mellitus. Phytomedicine, 2023 (PubMed: 36603341) [IF=6.7]

Application: WB    Species: Mouse    Sample:

Fig. 1. Celastrol reduces blood glucose levels in db/db mice, promotes insulin secretion, and improves hepatic glucose homeostasis metabolism. (A) The chemical structure of celastrol.(B–D) Effects of celastrol on blood glucose level (B), body weight (C), and food intake (D) in db/db mice. (E and F) Effect of celastrol on glucose tolerance test (GTT) results in db/db mice groups (E), area under the curve (AUC) for each group stated in (E) calculated using Graphpad Prism software v8.0.2 and plotted (F). All the data were expressed as mean ± SD (n = 6 – 7). §P < 0.05 or §§P < 0.01 vs. WT group. *P < 0.05 or **P < 0.01 vs. db/db group. (G) Effects of celastrol on insulin secretion in pancreas of db/db mice detected via immunohistochemical assay. (H) Effects of celastrol on insulin secretion in INS-1 cells. Student's t-test: §P < 0.05 vs. vehicle control group, **P < 0.01 vs. HG (high glucose) group. (I) INS-1 cells pretreated with 33.3 mM glucose (HG) for 2 h followed by celastrol (0.16, 0.5, or 1.5 μM) treatment for 24 h. Next, the cells were collected and subjected to western blot analysis. (J–K) HepG2 cells were pretreated with 33.3 mM glucose (HG) for 2 h followed by treatment with celastrol (0.1, 0.3, 1, or 3 μM) for 24 h. After treatment, the cells were incubated with 2-NBDG for 20 min, and these images were obtained using a fluorescence microscope (original magnification, 200 ×) (J). Quantitative 2NBDG uptake from each simple (K). Student's t-test:§§P < 0.01 vs. control group; **P < 0.01 vs. HG (high glucose) group. (L) HepG2 cells were pretreated with 33.3 mM glucose (HG) for 2 h and then treated with celastrol (1, 2, or 4 μM) for 24 h. The treated cells were collected and examined via western blotting.

2). Optimization on the extraction conditions of flavonoids from Suaeda glauca and the research of its hepatoprotection in mice. Fitoterapia, 2025 (PubMed: 40348032) [IF=2.5]

Application: WB    Species: Mouse    Sample:

Fig. 3. SGF ameliorates CCl4-induced liver glycogen accumulation. (A) Histology of liver sections were examined by APS (magnification × 200; bar: 100 μm) staining, respectively. (B) The representative blots of Laforin, GYS1, PYGL and G6PC. Relative protein levels of Laforin, GYS1, PYGL and G6PC were normalized to β-actin (n = 4). (C) Relative hepatic protein level of Laforin. (D) Relative hepatic level of GYS1. (E) Relative hepatic level of PYGL. (F) Relative hepatic level of G6PC. Data were expressed as the mean ± SEM. ###P < 0.001 versus the control-vehicle group; ⁎P < 0.05, ⁎⁎P < 0.01, ⁎⁎⁎P < 0.001 versus the CCl4-vehicle group. GYS1, glycogen synthase 1; PYGL, glycogen phosphorylase L; G6PC, glucose-6-phosphatase.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.