CLTB Antibody - #DF12900
| Product: | CLTB Antibody |
| Catalog: | DF12900 |
| Description: | Rabbit polyclonal antibody to CLTB |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 32 kDa; 25kD(Calculated). |
| Uniprot: | P09497 |
| RRID: | AB_2845861 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12900, RRID:AB_2845861.
Immunogens
- P09497 CLCB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P09497 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S11 | Phosphorylation | Uniprot | |
| S13 | Phosphorylation | Uniprot | |
| Y87 | Phosphorylation | Uniprot | |
| K122 | Ubiquitination | Uniprot | |
| K134 | Ubiquitination | Uniprot | |
| K184 | Ubiquitination | Uniprot | |
| T187 | Phosphorylation | Uniprot | |
| T190 | Phosphorylation | Uniprot | |
| K194 | Methylation | Uniprot | |
| K194 | Ubiquitination | Uniprot | |
| K204 | Methylation | Uniprot | |
| K204 | Ubiquitination | Uniprot | |
| S205 | Phosphorylation | P25098 (GRK2) | Uniprot |
| K207 | Methylation | Uniprot | |
| K207 | Ubiquitination | Uniprot | |
| S217 | Phosphorylation | Uniprot | |
| S221 | Phosphorylation | Uniprot | |
| K223 | Ubiquitination | Uniprot | |
| T225 | Phosphorylation | Uniprot |
Research Backgrounds
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.
Cytoplasmic vesicle membrane>Peripheral membrane protein>Cytoplasmic side. Membrane>Coated pit>Peripheral membrane protein>Cytoplasmic side.
Note: Cytoplasmic face of coated pits and vesicles.
Clathrin coats are formed from molecules containing 3 heavy chains and 3 light chains. Interacts (via N-terminus) with HIP1. Interacts with HIP1R.
Belongs to the clathrin light chain family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.