TECK Antibody - #DF13462
Product: | TECK Antibody |
Catalog: | DF13462 |
Description: | Rabbit polyclonal antibody to TECK |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 16kDa; 17kD(Calculated). |
Uniprot: | O15444 |
RRID: | AB_2846481 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13462, RRID:AB_2846481.
Fold/Unfold
A130072A22Rik; C-C motif chemokine 25; CCL 25; CCL25; CCL25_HUMAN; Chemokine (C C motif) ligand 25; Chemokine (CC motif) ligand 25; Chemokine C C motif ligand 25; Chemokine CC motif ligand 25; Chemokine TECK; Ck beta 15; Ckb 15; Ckb15; MGC125074; MGC150327; SCY A25; SCYA 25; SCYA25; Small inducible cytokine A25; Small inducible cytokine A25 isoform 1 precursor; Small inducible cytokine A25 isoform 2 precursor; Small inducible cytokine subfamily A (Cys Cys) member 25; Small inducible cytokine subfamily A Cys Cys member 25; Small inducible cytokine subfamily A, member 25; Small-inducible cytokine A25; TECK; TECKvar; Thymus expressed chemokine; Thymus-expressed chemokine;
Immunogens
A synthesized peptide derived from human TECK, corresponding to a region within the internal amino acids.
Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
- O15444 CCL25_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Research Backgrounds
Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Secreted.
Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > Intestinal immune network for IgA production. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.