Product: 15 Lipoxygenase 1 Antibody
Catalog: DF13494
Description: Rabbit polyclonal antibody to 15 Lipoxygenase 1
Application: WB
Cited expt.:
Reactivity: Human, Rat
Prediction: Mouse, Pig, Bovine, Sheep, Rabbit, Dog
Mol.Wt.: 74kDa(Observed); 75kD(Calculated).
Uniprot: P16050
RRID: AB_2846513

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Rat
Prediction:
Mouse(%), Pig(%), Bovine(%), Sheep(%), Rabbit(%), Dog(%)
Clonality:
Polyclonal
Specificity:
15 Lipoxygenase 1 Antibody detects endogenous levels of total 15 Lipoxygenase 1.
RRID:
AB_2846513
Cite Format: Affinity Biosciences Cat# DF13494, RRID:AB_2846513.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

15 lipoxygenase 1; 15 LIPOXYGENASE RETICULOCYTE ARACHIDONATE; 15 LOX; 15 LOX 1; 15-LOX; 15LOX 1; ALOX15; Arachidonate 15 lipoxygenase; Arachidonate 15-lipoxygenase; Arachidonate omega 6 lipoxygenase; Arachidonate omega-6 lipoxygenase; LOG15; LOX15_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human 15 Lipoxygenase 1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P16050 LOX15_HUMAN:

Detected in monocytes and eosinophils (at protein level). Expressed in airway epithelial cells.

Sequence:
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Sheep
100
Pig
88
Rabbit
88
Dog
86
Horse
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Converts arachidonic acid into 12-hydroperoxyeicosatetraenoic acid/12-HPETE and 15-hydroperoxyeicosatetraenoic acid/15-HPETE. Also converts linoleic acid to 13-hydroperoxyoctadecadienoic acid. May also act on (12S)-hydroperoxyeicosatetraenoic acid/(12S)-HPETE to produce hepoxilin A3. Probably plays an important role in the immune and inflammatory responses. Through the oxygenation of membrane-bound phosphatidylethanolamine in macrophages may favor clearance of apoptotic cells during inflammation by resident macrophages and prevent an autoimmune response associated with the clearance of apoptotic cells by inflammatory monocytes. In parallel, may regulate actin polymerization which is crucial for several biological processes, including macrophage function. May also regulate macrophage function through regulation of the peroxisome proliferator activated receptor signaling pathway. Finally, it is also involved in the cellular response to IL13/interleukin-13. In addition to its role in the immune and inflammatory responses, may play a role in epithelial wound healing in the cornea maybe through production of lipoxin A4. May also play a role in endoplasmic reticulum stress response and the regulation of bone mass.

Subcellular Location:

Cytoplasm>Cytosol. Cell membrane>Peripheral membrane protein. Lipid droplet.
Note: Predominantly cytosolic; becomes enriched at membranes upon calcium binding. Translocates from the cytosol to the plasma membrane when stimulated by IL13/interleukin-13 and in macrophages binding apoptotic cells.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in monocytes and eosinophils (at protein level). Expressed in airway epithelial cells.

Family&Domains:

The PLAT domain can bind calcium ions; this promotes association with membranes.

Belongs to the lipoxygenase family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Lipid metabolism > Linoleic acid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Nervous system > Serotonergic synapse.

References

1). Nme8 is essential for protection against chemotherapy drug cisplatin-induced male reproductive toxicity in mice. Cell death & disease, 2024 (PubMed: 39368984) [IF=8.1]

2). Glycine alleviates ovarian granulosa cell ferroptosis induced by ERα-mediated internalization of polystyrene microplastics. Communications biology, 2026 (PubMed: 41851278) [IF=5.9]

3). Regulation of optimized new Shengmai powder on cardiomyocyte apoptosis and ferroptosis in ischemic heart failure rats: The mediating role of phosphatidylinositol-3-kinase/protein kinase B/tumor protein 53 signaling pathway. Journal of ethnopharmacology, 2024 (PubMed: 38692417) [IF=4.8]

4). Identification of Genes Reveals the Mechanism of Cell Ferroptosis in Diabetic Nephropathy. Frontiers in Physiology, 2022 (PubMed: 35721535) [IF=4.0]

Application: IF/ICC    Species: Mice    Sample:

FIGURE 5 Expression of ALOX15 mRNA and protein in DN. (A) Real-time PCR assay of ALOX15 mRNA in STZ-induced diabetes mice models. (B) Real-time PCR assay of ALOX15 mRNA in db/db mice models. (C) IHC assay of ALOX15 protein expression on kidney tissues of STZ-induced diabetic mice models. Scale bar = 20 μm. (D) IHC assay of ALOX15 protein expression on kidney tissues of db/db mice models. Scale bar = 20 μm. (E) IHC assay of ALOX15 protein expression on human renal biopsy tissues. Scale bar = 20 μm. (F) Immunofluorescence double staining of GPX4 and ALOX15 protein co-expression on mice glomerulus. Scale bar = 20 μm. Results represented the mean ± SEM for six samples/group. * p < 0.05, ** p < 0.01, *** p < 0.001 vs. NC; ### p < 0.001 vs. EDN. NC normal control; DN diabetic nephropathy; EDN early DN; ADN advanced DN; STZ streptozotocin; IHC immunohistochemical staining.

5). CircRNA 06209 inhibits cataract development by sponging miR-6848-5p and regulating ALOX15 expression. Experimental eye research, 2023 (PubMed: 37673368) [IF=3.0]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.