DLST Antibody - #DF13671
| Product: | DLST Antibody |
| Catalog: | DF13671 |
| Description: | Rabbit polyclonal antibody to DLST |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 48kDa, 40 kDa; 49kD(Calculated). |
| Uniprot: | P36957 |
| RRID: | AB_2846690 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13671, RRID:AB_2846690.
Fold/Unfold
2-oxoglutarate dehydrogenase complex component E2; Dihydrolipoamide S succinyltransferase (E2 component of 2 oxo glutarate complex); Dihydrolipoamide S succinyltransferase; Dihydrolipoamide succinyltransferase component of 2 oxoglutarate dehydrogenase complex; Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex; Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex; Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex mitochondrial; Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex; Dlst; DLTS; E2; E2K; mitochondrial; ODO2_HUMAN; OGDC-E2;
Immunogens
A synthesized peptide derived from human DLST, corresponding to a region within N-terminal amino acids.
- P36957 ODO2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Dihydrolipoamide succinyltransferase (E2) component of the 2-oxoglutarate dehydrogenase complex. The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion. A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A.
Mitochondrion matrix. Nucleus.
Note: Mainly localizes in the mitochondrion. A small fraction localizes to the nucleus, where the 2-oxoglutarate dehydrogenase complex is required for histone succinylation.
Belongs to the 2-oxoacid dehydrogenase family.
Research Fields
· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).
· Metabolism > Amino acid metabolism > Lysine degradation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Carbon metabolism.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.