Phospho-CDKN2A/p16INK4a (Ser152) Antibody - #AF3667
Product: | Phospho-CDKN2A/p16INK4a (Ser152) Antibody |
Catalog: | AF3667 |
Description: | Rabbit polyclonal antibody to Phospho-CDKN2A/p16INK4a (Ser152) |
Application: | IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 17kD(Calculated). |
Uniprot: | P42771 |
RRID: | AB_2846981 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3667, RRID:AB_2846981.
Fold/Unfold
Cyclin-dependent kinase inhibitor 2A;Cyclin-dependent kinase 4 inhibitor A;CDK4I;Multiple tumor suppressor 1;MTS-1;p16-INK4a;p16-INK4;p16INK4A;CDKN2A;CDKN2;MTS1;
Immunogens
A synthesized peptide derived from human CDKN2A/p16INK4a around the phosphorylation site of Ser152.
Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.
- P42771 CDN2A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
PTMs - P42771 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S7 | Phosphorylation | Q13535 (ATR) | Uniprot |
S8 | Phosphorylation | O14920 (IKBKB) , Q13535 (ATR) | Uniprot |
Y44 | Phosphorylation | Uniprot | |
R99 | Methylation | Uniprot | |
R131 | Methylation | Uniprot | |
R138 | Methylation | Uniprot | |
S140 | Phosphorylation | Q13535 (ATR) | Uniprot |
S152 | Phosphorylation | Q13535 (ATR) | Uniprot |
Research Backgrounds
Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.
Phosphorylation seems to increase interaction with CDK4.
Cytoplasm. Nucleus.
Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.
Heterodimer with CDK4 or CDK6. Predominant p16 complexes contained CDK6. Interacts with CDK4 (both 'T-172'-phosphorylated and non-phosphorylated forms); the interaction inhibits cyclin D-CDK4 kinase activity. Interacts with ISCO2.
Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > p53 signaling pathway. (View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
· Human Diseases > Cancers: Specific types > Pancreatic cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Glioma. (View pathway)
· Human Diseases > Cancers: Specific types > Melanoma. (View pathway)
· Human Diseases > Cancers: Specific types > Bladder cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia. (View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.