MKK3 Antibody - #AF6327

(4)   (5)  
Product: MKK3 Antibody
Catalog: AF6327
Description: Rabbit polyclonal antibody to MKK3
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 40kDa; 39kD(Calculated).
Uniprot: P46734
RRID: AB_2835183

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
MKK3 Antibody detects endogenous levels of total MKK3.
RRID:
AB_2835183
Cite Format: Affinity Biosciences Cat# AF6327, RRID:AB_2835183.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AW212142; dual specificity mitogen activated protein kinase kinase 3; Dual specificity mitogen-activated protein kinase kinase 3; MAP kinase kinase 3; map2k3; MAPK ERK kinase 3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3; MEK 3; MEK3; Mitogen activated protein kinase kinase 3; MKK 3; MKK3; mMKK3b; MP2K3_HUMAN; PRKMK 3; PRKMK3; protein kinase, mitogen-activated, kinase 3; SAPK kinase 2; SAPKK 2; SAPKK2; Stress activated protein kinase kinase 2;

Immunogens

Immunogen:
Uniprot:

P46734(MP2K3_HUMAN) >>Visit HPA database.

Gene(ID):
MAP2K3(5606)
Expression:
P46734 MP2K3_HUMAN:

Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.

Description:
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter.
Sequence:
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P46734 As Substrate

Site PTM Type Enzyme
M1 Acetylation
S3 Phosphorylation
S15 Phosphorylation
S28 Phosphorylation
S31 Phosphorylation
K32 Ubiquitination
T39 Phosphorylation
K80 Ubiquitination
K93 Ubiquitination
S101 Phosphorylation
K105 Ubiquitination
K183 Ubiquitination
S189 Phosphorylation
K192 Ubiquitination
T193 Phosphorylation
K200 Ubiquitination
S212 Phosphorylation
Y214 Phosphorylation
S218 Phosphorylation Q99759 (MAP3K3) , P41279 (MAP3K8) , Q9UL54 (TAOK2) , Q16584 (MAP3K11) , Q7L7X3 (TAOK1) , Q99683 (MAP3K5) , P46734 (MAP2K3)
T222 Phosphorylation Q16584 (MAP3K11) , P46734 (MAP2K3)
Y230 Phosphorylation
K243 Ubiquitination
Y245 Phosphorylation
S249 Phosphorylation
S253 Phosphorylation
K279 Sumoylation
K279 Ubiquitination
K332 Ubiquitination
K340 Ubiquitination

PTMs - P46734 As Enzyme

Substrate Site Source
O15264 (MAPK13) T180 Uniprot
O15264 (MAPK13) Y182 Uniprot
P46734 (MAP2K3) S218 Uniprot
P46734 (MAP2K3) T222 Uniprot
P53778 (MAPK12) T183 Uniprot
P53778 (MAPK12) Y185 Uniprot
Q16539 (MAPK14) T180 Uniprot
Q16539 (MAPK14) Y182 Uniprot

Research Backgrounds

Function:

Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.

PTMs:

Autophosphorylated. Phosphorylation on Ser-218 and Thr-222 by MAP kinase kinase kinases regulates positively the kinase activity. Phosphorylated by TAOK2.

Yersinia yopJ may acetylate Ser/Thr residues, preventing phosphorylation and activation, thus blocking the MAPK signaling pathway.

Tissue Specificity:

Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.

Subunit Structure:

Component of a signaling complex containing at least AKAP13, PKN1, MAPK14, ZAK and MAP2K3. Within this complex, AKAP13 interacts directly with PKN1, which in turn recruits MAPK14, MAP2K3 and ZAK. Binds to DYRK1B/MIRK and increases its kinase activity. Part of a complex with MAP3K3, RAC1 and CCM2 (By similarity). Interacts with ARRB1. Interacts with Yersinia yopJ.

Family&Domains:

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.   (View pathway)

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels.   (View pathway)

References

1). Structure-based discovery of 1H-indole-2-carboxamide derivatives as potent ASK1 inhibitors for potential treatment of ulcerative colitis. European Journal of Medicinal Chemistry, 2021 (PubMed: 33360793) [IF=6.0]

Application: WB    Species: mice    Sample: colon tissues

Fig. 6. Inhibitory effect of compounds 19 and 6 on activated ASK1-p38/JNK signaling and up-regulated inflammatory cytokines in colon tissues of DSS-induced UC mice. (A) Western blot analysis of the protein levels of ASK1-MKK3/6-p38 and ASK1-MKK4/7-JNK signaling pathways as well as corresponding phosphorylated proteins. GAPDH was used as the loading control protein. (B) Quantitative analysis of the ratios of phosphorylated proteins normalized to their unphosphorylated form. (C) The levels of inflammatory cytokines IL-1b, IL-6, TNF-a were detected using ELISA kits. Data are expressed as mean ± SEM (n ¼ 5e6 per group). Compared with the control group: # P < 0.05, ## P < 0.01, ### P < 0.001; Compared with the DSS þ Veh group: * P < 0.05, ** P < 0.01, *** P < 0.001.
2). Regulation of optimized new Shengmai powder on cardiomyocyte apoptosis and ferroptosis in ischemic heart failure rats: The mediating role of phosphatidylinositol-3-kinase/protein kinase B/tumor protein 53 signaling pathway. Journal of ethnopharmacology, 2024 (PubMed: 38692417) [IF=4.8]
3). Resveratrol alleviates heat-stress-induced impairment of the jejunal mucosa through TLR4/MAPK signaling pathway in black-boned chicken. Poultry science, 2024 (PubMed: 37980746) [IF=3.8]

Application: WB    Species: chicken    Sample: jejunal mucosa

Figure 4 Expression of MKK3, p53, and MYD88 protein (A) and the relative gray values of MKK3/β-actin, p53 /β-actin, and MYD88/β-actin (B) in the jejunal mucosa. HT, high temperature treatment (37°C ± 2°C); HT+Res, HT+400 mg/kg resveratrol; NT, normal temperature treatment (24°C ± 2°C); NT+Res, NT+400 mg/kg resveratrol. One-way ANOVA and Duncan's multiple range test were used for comparing the differences among NT, NT+Res, HT, HT+Res groups. The values with different superscript letters are different (P < 0.05). Error bars stand for the standard error of mean.
4). Effect of IL-17 on pulmonary artery smooth muscle cells and connective tissue disease-associated pulmonary arterial hypertension. Immunity, inflammation and disease, 2024 (PubMed: 38577988) [IF=3.2]

Application: WB    Species: Human    Sample:

Figure 5 (A) Protein expression of mitogen‐activated protein kinase signal pathway components; (B) inhibition with a highly specific p38 inhibitor decreased proliferation of pulmonary artery smooth muscle cells (PASMCs) at 24 h (2.34 ± 0.13 vs. 3.29 ± 0.06; p＜.001), 48 h (2.37 ± 0.08 vs. 3.33 ± 0.03; p＜0.001) and 72 h (2.52 ± 0.08 vs. 3.52 ± 0.03; p＜.001), respectively (n = 5 each group). GAPDH, glyceraldehyde‐3‐phosphate dehydrogenase; IL, interleukin; MAPK, mitogen‐activated protein kinase.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.