Product: HDAC2 Antibody
Catalog: AF6470
Description: Rabbit polyclonal antibody to HDAC2
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.: 55kDa(Observed); 55kD(Calculated).
Uniprot: Q92769
RRID: AB_2835289

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(82%)
Clonality:
Polyclonal
Specificity:
HDAC2 Antibody detects endogenous levels of total HDAC2.
RRID:
AB_2835289
Cite Format: Affinity Biosciences Cat# AF6470, RRID:AB_2835289.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

D10Wsu179e; HD 2; HD2; HDAC 2; Hdac2; HDAC2_HUMAN; Histone deacetylase 2 (HD2); Histone deacetylase 2; OTTHUMP00000017046; OTTHUMP00000227077; OTTHUMP00000227078; RPD3; transcriptional regulator homolog RPD3; YAF1; YY1 associated factor 1; YY1 transcription factor binding protein; Yy1bp;

Immunogens

Immunogen:

A synthesized peptide derived from human HDAC2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q92769 HDAC2_HUMAN:

Widely expressed; lower levels in brain and lung.

Description:
HDAC2 a transcriptional regulator of the histone deacetylase family, subfamily 1. Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation plays a role in epigenetic repression and transcriptional regulation, cell cycle progression and developmental events.
Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Chicken
100
Rabbit
100
Xenopus
82
Pig
0
Dog
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.

PTMs:

S-nitrosylated by GAPDH. In neurons, S-Nitrosylation at Cys-262 and Cys-274 does not affect the enzyme activity but abolishes chromatin-binding, leading to increases acetylation of histones and activate genes that are associated with neuronal development. In embryonic cortical neurons, S-Nitrosylation regulates dendritic growth and branching.

Subcellular Location:

Nucleus. Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed; lower levels in brain and lung.

Family&Domains:

Belongs to the histone deacetylase family. HD type 1 subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Environmental Information Processing > Signal transduction > Notch signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Human Diseases > Substance dependence > Alcoholism.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway - multiple species.   (View pathway)

· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.   (View pathway)

References

1). Galangin 3-methyl ether alleviates mouse hypertrophic cardiomyopathy via targeting HDAC2 and subsequently inactivating the PI3K-AKT signaling pathway. Acta pharmacologica Sinica, 2025 (PubMed: 41176539) [IF=6.9]

Application: WB    Species: human    Sample: H9c2, hESC-CMs and cardiac tissues

Fig. 7: Galangin 3-methyl ether (G3-ME) prevents pathological cardiac hypertrophy by directly targeting HDAC2. a The flowchart of network pharmacology and the protein-protein interaction diagram. b KEGG enrichment analysis according to 42 potential targets of G3-ME. c The binding energy between G3-ME and potential targets enriched in the PI3K-AKT signaling pathway. d Representative schematic diagram of molecular docking between HDAC2 and G3-ME. e Schematic diagram of HDAC2 regulating the PI3K-AKT signaling pathway. f, g The protein expression levels of p-HDAC2 and HDAC2 in H9c2, hESC-CMs and cardiac tissues of wild-type (WT) or Myh6R404Q mice. n = 4 per group. h Drug affinity reaction target stability (DARTs) assay was performed in vitro and in vivo on H9c2. i DARTs assay was performed in vitro and in vivo on hESC-CMs. j Cellular thermal shift assay was performed on H9c2 and hESC-CMs, respectively. k The results of surface plasmon resonance indicated a direct binding interaction between G3-ME and HDAC2, with a binding affinity of 3.36 μM. The values are mean ± SEM.

2). DUSP26: Unveiling a critical molecular mediator and therapeutic target in developmental dysplasia of the hip‑associated secondary osteoarthritis. International journal of molecular medicine, 2026 (PubMed: 41789628) [IF=5.7]

3). Chidamide, a subtype-selective histone deacetylase inhibitor, enhances Bortezomib effects in multiple myeloma therapy. Journal of Cancer, 2023 (PubMed: 34539893) [IF=3.3]

Application: WB    Species: Human    Sample: Multiple myeloma cells

Supplementary Figure S2. The protein levels of HDAC2 and HDAC8 in ARP-1 and XG1 cells treated with different concentrations of CHI for 48 hours.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.