Product: LDHA Mouse Monoclonal Antibody
Catalog: BF9380
Description: Mouse monoclonal antibody to LDHA
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Bovine, Sheep, Rabbit, Dog
Mol.Wt.: 37kDa; 37kD(Calculated).
Uniprot: P00338

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9380]
Specificity:
LDHA Mouse Monoclonal Antibody detects endogenous levels of total LDHA.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cell proliferation-inducing gene 19 protein; L lactate dehydrogenase A chain; Lactate dehydrogenase A; LDH A; LDH M; LDH muscle subunit; LDH1; LDH5; LDHA; PIG 19; PIG19; Renal carcinoma antigen NY-REN-59;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Lactate dehydrogenase (LDH) catalyzes the interconversion of pyruvate and NADH to lactate and NAD+. When the oxygen supply is too low for mitochondrial ATP production, this reaction recycles NADH generated in glycolysis to NAD+, which reenters glycolysis. The major form of LDH found in muscle cells is the A (LDHA) isozyme. The LDHA promoter contains HIF-1α binding sites (1). LDHA expression is induced under hypoxic conditions (2). During intensive and prolonged muscle exercise, lactate accumulates in muscle cells when the supply of oxygen does not meet demand. When oxygen levels return to normal, LDH converts lactate to pyruvate to generate ATP in the mitochondrial electron transport chain.
Sequence:
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

PTMs - P00338 As Substrate

Site PTM Type Enzyme
A2 Acetylation
T3 Phosphorylation
K5 Acetylation
K5 Methylation
K5 Ubiquitination
Y10 Phosphorylation P11362 (FGFR1) , P04626 (ERBB2) , P12931 (SRC)
K14 Acetylation
K14 Sumoylation
K14 Ubiquitination
T18 Phosphorylation
K22 Acetylation
K57 Acetylation
K57 Ubiquitination
K59 Ubiquitination
T74 Phosphorylation
K76 Ubiquitination
K81 Acetylation
K81 Ubiquitination
Y83 Phosphorylation P11362 (FGFR1)
S89 Phosphorylation
K90 Ubiquitination
T95 Phosphorylation
K118 Acetylation
K118 Methylation
K118 Ubiquitination
K126 Acetylation
K126 Ubiquitination
Y127 Phosphorylation
S128 Phosphorylation
K132 Acetylation
K132 Ubiquitination
Y145 Phosphorylation
K155 Ubiquitination
R157 Methylation
S161 Phosphorylation
S167 Phosphorylation
R169 Methylation
Y172 Phosphorylation
S184 Phosphorylation
K212 Ubiquitination
K222 Acetylation
K222 Ubiquitination
K224 Acetylation
K224 Ubiquitination
K228 Acetylation
K228 Ubiquitination
K232 Acetylation
K232 Ubiquitination
S237 Phosphorylation
Y239 Phosphorylation
K243 Acetylation
K243 Ubiquitination
K245 Ubiquitination
T248 Phosphorylation P06493 (CDK1)
S249 Phosphorylation
R269 Methylation
K278 Acetylation
K278 Methylation
K278 Ubiquitination
K284 Ubiquitination
K305 Ubiquitination
T309 Phosphorylation
S310 Phosphorylation
K317 Ubiquitination
K318 Acetylation
K318 Ubiquitination
S319 Phosphorylation
T322 Phosphorylation
K328 Acetylation
K328 Sumoylation
K328 Ubiquitination

Research Backgrounds

PTMs:

ISGylated.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homotetramer.

Family&Domains:

Belongs to the LDH/MDH superfamily. LDH family.

Research Fields

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer.   (View pathway)

· Metabolism > Carbohydrate metabolism > Glycolysis / Gluconeogenesis.

· Metabolism > Amino acid metabolism > Cysteine and methionine metabolism.

· Metabolism > Carbohydrate metabolism > Pyruvate metabolism.

· Metabolism > Carbohydrate metabolism > Propanoate metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Endocrine system > Glucagon signaling pathway.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.