CDKN2A/p16INK4a Recombinant Rabbit mAb - #BF3122

WB 1:1000, IHC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Human

Monoclonal [ReFirm22569]

CDKN2A/p16INK4a Recombinant Rabbit mAb detects endogenous levels of CDKN2A/p16INK4a.

Unconjugated.

Affinity-chromatography.

Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

P42771(CDN2A_HUMAN) >>Visit HPA database.

P42771 CDN2A_HUMAN:

Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.

This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported,two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene,this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with,and sequester,the E3 ubiquitin-protein ligase MDM2,a protein responsible for the degradation of p53. In spite of the structural and functional differences,the CDK inhibitor isoforms and the ARF product encoded by this gene,through the regulatory roles of CDK4 and p53 in cell cycle G1 progression,share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors,and is known to be an important tumor suppressor gene.

•    P42771 CDN2A_HUMAN:
• Protein BLAST With
• NCBI/
• ExPASy/
• Uniprot

MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD