Product: CTSK Recombinant Rabbit mAb
Catalog: BF3166
Description: Rabbit monoclonal antibody to CTSK
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 37 kDa(Observed); 37kD(Calculated).
Uniprot: P43235

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000, IHC 1:200-1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm22613]
Specificity:
CTSK Recombinant Rabbit mAb detects endogenous levels of CTSK.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cathepsin K; Cathepsin O; Cathepsin O1; Cathepsin O2; Cathepsin X; CATK_HUMAN; CTS02; Ctsk; CTSO; CTSO1; CTSO2; MGC23107; PKND; PYCD;

Immunogens

Immunogen:

A synthetic peptide from human CTSK

Uniprot:
Gene(ID):
Expression:
P43235 CATK_HUMAN:

Predominantly expressed in osteoclasts (bones) (PubMed:7805878). Expressed in thyroid epithelial cells (PubMed:11082042).

Description:
The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein,which is a member of the peptidase C1 protein family,is predominantly expressed in osteoclasts. However,the encoded protein is also expressed in a significant fraction of human breast cancers,where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis,an autosomal recessive disease characterized by osteosclerosis and short stature.
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Research Backgrounds

Function:

Thiol protease involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Involved in the release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen.

Subcellular Location:

Lysosome. Secreted. Apical cell membrane>Peripheral membrane protein>Extracellular side.
Note: Localizes to the lumen of thyroid follicles and to the apical membrane of thyroid epithelial cells.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Predominantly expressed in osteoclasts (bones). Expressed in thyroid epithelial cells.

Family&Domains:

Belongs to the peptidase C1 family.

Research Fields

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.