Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000, IHC 1:200-1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm22928]
Specificity:
FOLR1 Recombinant Rabbit mAb detects endogenous levels of FOLR1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

adult; Adult folate binding protein; Adult folate-binding protein; FBP; Folate Receptor 1 Adult; Folate receptor 1; Folate Receptor 1 Precursor; Folate receptor adult; Folate receptor alpha; Folate receptor; FOLR; FOLR1; FOLR1_HUMAN; FR alpha; FR-alpha; FRalpha; KB cells FBP; MOV18; Ovarian cancer associated antigen; Ovarian tumor associated antigen; Ovarian tumor associated antigen MOv18; Ovarian tumor-associated antigen MOv18;

Immunogens

Immunogen:

A synthetic peptide from human FOLR1

Uniprot:
Gene(ID):
Expression:
P15328 FOLR1_HUMAN:

Primarily expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum. Detected in placenta and thymus epithelium.

Description:
The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives,and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters,multiple transcription start sites,and alternative splicing,multiple transcript variants encoding the same protein have been found for this gene.
Sequence:
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS

Research Backgrounds

Function:

Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation.

PTMs:

The secreted form is derived from the membrane-bound form either by cleavage of the GPI anchor, or/and by proteolysis catalyzed by a metalloprotease.

Subcellular Location:

Cell membrane>Lipid-anchor. Secreted. Cytoplasmic vesicle. Cytoplasmic vesicle>Clathrin-coated vesicle. Endosome. Apical cell membrane.
Note: Endocytosed into cytoplasmic vesicles and then recycled to the cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Primarily expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum. Detected in placenta and thymus epithelium.

Family&Domains:

Belongs to the folate receptor family.

Research Fields

· Cellular Processes > Transport and catabolism > Endocytosis.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.