COX17 Antibody - #DF3558
| Product: | COX17 Antibody |
| Catalog: | DF3558 |
| Description: | Rabbit polyclonal antibody to COX17 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 7 KD; 7kD(Calculated). |
| Uniprot: | Q14061 |
| RRID: | AB_2835931 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3558, RRID:AB_2835931.
Fold/Unfold
COX 17; COX17; COX17 cytochrome c oxidase assembly homolog (S. cerevisiae); COX17 cytochrome c oxidase assembly homolog; COX17 homolog cytochrome c oxidase assembly protein; COX17_HUMAN; cytochrome c oxidase assembly protein cox17 homolog; Cytochrome c oxidase copper chaperone; Human homolog of yeast mitochondrial copper recruitment; MGC104397; MGC117386; OTTHUMP00000215284; OTTHUMP00000215285;
Immunogens
A synthesized peptide derived from human COX17, corresponding to a region within N-terminal amino acids.
- Q14061 COX17_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Copper metallochaperone essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Binds two copper ions and delivers them to the metallochaperone SCO1 which transports the copper ions to the Cu(A) site on the cytochrome c oxidase subunit II (MT-CO2/COX2).
Mitochondrion intermembrane space. Cytoplasm.
Ubiquitous.
Belongs to the COX17 family.
Research Fields
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.