Product: SOD2/MnSOD Antibody
Catalog: AF5144
Description: Rabbit polyclonal antibody to SOD2/MnSOD
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Xenopus
Mol.Wt.: 25 kDa(Observed); 25kD(Calculated).
Uniprot: P04179
RRID: AB_2837630

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Zebrafish(%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
SOD2/MnSOD Antibody detects endogenous levels of total SOD2/MnSOD.
RRID:
AB_2837630
Cite Format: Affinity Biosciences Cat# AF5144, RRID:AB_2837630.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Indophenoloxidase B; IPO B; IPOB; Manganese containing superoxide dismutase; Manganese SOD; Manganese superoxide dismutase; Mangano superoxide dismutase; Mn SOD; Mn superoxide dismutase; MNSOD; MVCD6; SOD 2; SOD2; SODM_HUMAN; Superoxide dismutase [Mn] mitochondrial; Superoxide dismutase [Mn], mitochondrial; Superoxide dismutase 2 mitochondrial;

Immunogens

Immunogen:

A synthesized peptide derived from human SOD2/MnSOD, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
Mn SOD antibody Mn superoxide dismutase antibody MNSOD antibody MVCD6 antibody SOD 2 antibody SOD2 antibody SODM_HUMAN antibody
Sequence:
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Xenopus
100
Zebrafish
100
Rabbit
100
Dog
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.

PTMs:

Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.

Acetylation at Lys-122 decreases enzymatic activity. Deacetylated by SIRT3 upon exposure to ionizing radiations or after long fasting (By similarity).

Polyubiquitinated; leading to proteasomal degradation. Deubiquitinated by USP36 which increases protein stability.

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the iron/manganese superoxide dismutase family.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Organismal Systems > Aging > Longevity regulating pathway.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway - multiple species.   (View pathway)

References

1). Catalytic Nanodots-Driven Pyroptosis Suppression in Nucleus Pulposus for Antioxidant Intervention of Intervertebral Disc Degeneration. Advanced materials (Deerfield Beach, Fla.), 2024 (PubMed: 38299823) [IF=27.4]

2). Resveratrol and its derivative pterostilbene attenuate oxidative stress-induced intestinal injury by improving mitochondrial redox homeostasis and function via SIRT1 signaling. Free radical biology & medicine, 2021 (PubMed: 34648904) [IF=7.1]

3). Aqueous extract of Phellinus igniarius ameliorates hyperuricemia and renal injury in adenine/potassium oxonate-treated mice. Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 2024 (PubMed: 38879892) [IF=6.9]

4). circ0066187 promotes pulmonary fibrogenesis through targeting STAT3-mediated metabolism signal pathway. Cellular and molecular life sciences : CMLS, 2025 (PubMed: 39969586) [IF=6.2]

Application: WB    Species: Mouse    Sample:

Fig. 9 Integrative analysis of proteomics and metabolomics. A Venn diagram showed three pathways co-enriched in proteomics and metabolomics, including Protein digestion and absorption, PI3K-Akt signaling pathway, and FoxO signaling pathway. B Interaction network diagram of differential proteins and metabolites among the three pathways. C Western blot verified that DPP4, CCND1, CDK2, and FGF2 were up-regulated and COL6A1 and SOD2 were down-regulated in the TGF-β1-treated MRC-5 cells and BLM-induced mice. D l-Glutamine, l-proline, and AMP increased, and l-arginine, l-phenylalanine, l-lysine, and l-tryptophan decreased in the TGF-β1-treated MRC-5 cells and BLM-induced mice. E Western blot demonstrated that circ0066187 knockdown decreased DPP4, CCND1, CDK2, and FGF2 expression and increased COL6A1 and SOD2 expression compared with those in TGF-β1-treated group. Circ0066187 overexpression enhanced DPP4, CCND1, CDK2, and FGF2 expression, and decreased COL6A1 and SOD2 expression. F miR-29b-2-5p mimic enhanced COL6A1 and SOD2 expression and inhibited DPP4, CCND1, CDK2, and FGF2 expression. miR-29b-2-5p inhibitor enhanced DPP4, CCND1, CDK2, and FGF2 expression and inhibited COL6A1 and SOD2 expression. G Rescue experiment of Western blot demonstrated that the miR-29b-2-5p inhibitor reversed the downward trend of DPP4, CCND1, CDK2, and FGF2 and the upward trend of COL6A1 and SOD2 caused by si-circ0066187. miR-29b-2-5p mimic reversed the upward trend of DPP4, CCND1, CDK2, and FGF2 and the downward trend of COL6A1 and SOD2 caused by circ0066187 overexpression. H Western blot showed that si-STAT3 decreased DPP4, CCND1, CDK2, and FGF2 expression, and increased COL6A1 and SOD2 expression. Overexpressed STAT3 enhanced DPP4, CCND1, CDK2, and FGF2 expression and inhibited COL6A1 and SOD2 expression. I Rescue experiment showed that STAT3 overexpression reversed the downward trend of DPP4, CCND1, CDK2, and FGF2 and the upward trend of COL6A1 and SOD2 caused by si-circ0066187. si-STAT3 reversed the upward trend of DPP4, CCND1, CDK2, and FGF2 and the downward trend of COL6A1 and SOD2 caused by circ0066187 overexpression. NC represents negative control, BP represents blank plasmid, and RP represents the recombinant plasmid of overexpressed circ0066187. OE-STAT3 represents overexpressed STAT3. Each bar represents the mean ± SD; n = 6; *p 

5). Silica nanoparticles cause ovarian dysfunction and fertility decrease in mice via oxidative stress-activated autophagy and apoptosis. Ecotoxicology and environmental safety, 2024 (PubMed: 39303637) [IF=6.2]

6). Procyanidin B2 regulates the Sirt1/Nrf2 signaling pathway to improve random-pattern skin flap survival. Phytotherapy Research, 2023 (PubMed: 37128130) [IF=6.1]

7). Drug D, a Diosgenin Derive, Inhibits L-Arginine-Induced Acute Pancreatitis through Meditating GSDMD in the Endoplasmic Reticulum via the TXNIP/HIF-1α Pathway. Nutrients, 2022 (PubMed: 35807771) [IF=5.9]

8). DEK deficiency suppresses mitophagy to protect against house dust mite-induced asthma. Frontiers in immunology, 2024 (PubMed: 38274803) [IF=5.7]

9). 3-MCPD Induced Mitochondrial Damage of Renal Cells Via the Rhythmic Protein BMAL1 Targeting SIRT3/SOD2. Journal of Agricultural and Food Chemistry, 2023 (PubMed: 37750480) [IF=5.7]

10). Gastroprotective mechanism of modified lvdou gancao decoction on ethanol-induced gastric lesions in mice: Involvement of Nrf-2/HO-1/NF-κB signaling pathway. Frontiers in Pharmacology, 2022 (PubMed: 36120337) [IF=5.6]

Application: WB    Species: Mouse    Sample: gastric tissues

FIGURE 7 Effect of MLG on some protein levels in ethanol-induced gastric lesions mice. Some representative western blot bands (A). Protein levels of SOD1/GAPDH (B), SOD2/GAPDH (C), iNOS/GAPDH (D), nNOS/GAPDH (E), eNOS/GAPDH (F), COX2/GAPDH (G), p38/GAPDH (H) in mice gastric tissues. SOD1, Superoxide dismutase one or Cu/Zn-superoxide dismutase; SOD2/Mn SOD, superoxide dismutase 2. Control: the group administered zero ethanol; Model: the group administered ethanol intragastrically (13.25 ml/kg BW); MLG-L: low-dose (5 g/kg body weight) MLG-treated group; MLG-M: medium-dose (10 g/kg body weight) MLG-treated group; MLG-H: high-dose (20 g/kg body weight) MLG-treated group; CBP: the group receiving Colloid Bismuth Pectin (57 mg/kg body weight). Each group’s data was expressed as mean ± standard deviation (SD), n = 6. By one-way analysis of variance (ANOVA) test, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 vs. each group. Whole page of western blot can be found in Supplementary Figures S1, S3, S7, S8, S10, S14, S15, respectively.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.